DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG33721 and CG14518

DIOPT Version :9

Sequence 1:NP_001036743.1 Gene:CG33721 / 3885576 FlyBaseID:FBgn0053721 Length:181 Species:Drosophila melanogaster
Sequence 2:NP_651653.2 Gene:CG14518 / 43421 FlyBaseID:FBgn0039621 Length:179 Species:Drosophila melanogaster


Alignment Length:155 Identity:40/155 - (25%)
Similarity:81/155 - (52%) Gaps:10/155 - (6%)


- Green bases have known domain annotations that are detailed below.


  Fly    26 EFTNFKCHVKDPTYLSFEYCFIKSVNRTYKYISLKANMYEVPITNASAKLQISRRFRSYMPITIA 90
            :.||..|...:.:::.|..|.:::|:|....:::.||:.. |:.:...|.::.:|...|.|...:
  Fly    26 KMTNAVCETYNKSWVEFGLCRLRAVSRNKVCLNVDANLLH-PVHDVIVKARLLKRANGYKPWLYS 89

  Fly    91 ASIDVCKYMAYKKNLANPMLRLFEEITKKYTNTNHKCPYDHDLIIDRLPSKYL-SEHFTNILPLP 154
            .|.|.|:::. ::|  |.::|:..|:.|:|:..||.|||   :.:.::.:.|| ||....  |:|
  Fly    90 VSFDGCQFIR-RRN--NALIRIVWELFKEYSTINHTCPY---VGLQQVKNFYLRSEKLPT--PIP 146

  Fly   155 PGDYSFNSIWYSRNIERATISIYYT 179
            .|:|.....|......:|..::|:|
  Fly   147 TGEYLLMIDWVFNKKPQAATNVYFT 171

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG33721NP_001036743.1 DUF1091 74..160 CDD:284008 26/86 (30%)
CG14518NP_651653.2 DM8 83..173 CDD:214778 28/97 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000262
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR20898
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X90
44.010

Return to query results.
Submit another query.