DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG33721 and CG33914

DIOPT Version :9

Sequence 1:NP_001036743.1 Gene:CG33721 / 3885576 FlyBaseID:FBgn0053721 Length:181 Species:Drosophila melanogaster
Sequence 2:NP_001027394.2 Gene:CG33914 / 3772464 FlyBaseID:FBgn0053914 Length:189 Species:Drosophila melanogaster


Alignment Length:165 Identity:46/165 - (27%)
Similarity:76/165 - (46%) Gaps:13/165 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly    25 LEFTNFKCHVKDPTYLSFEYCFIKSVNRTYKYISLKANMYEVPITNASAKLQISRR-------FR 82
            :.|||..|..||.:....|||.:.::::....|||:..|.:...||.....|:..|       ..
  Fly    26 MRFTNVTCESKDLSMSIVEYCAVTTLSKNKNSISLRYAMLKPMFTNIEIYFQLMTRGSESIHAAS 90

  Fly    83 SYMPITIAASIDVCKYMAYKKNLANPMLRLFEEITKKYTNTNHKCPYDHD--LIIDRLPSKYLSE 145
            ::.|......:|:|::.   ||..|.:.|:..|....:||.||.|||..:  :.||.|.:..:|.
  Fly    91 NWQPFLHTMKLDLCRFW---KNHHNHLARMVFEFIDGHTNMNHTCPYTKEKYISIDDLTNTEVSA 152

  Fly   146 HFTNILPLPPGDYSFNSIWYSRNIERATISIYYTV 180
            ....: |:|.|.|:..:.|.:.||.|...:.|:.|
  Fly   153 KIRGV-PMPKGFYALFTTWSTENITRVVTNFYFEV 186

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG33721NP_001036743.1 DUF1091 74..160 CDD:284008 25/94 (27%)
CG33914NP_001027394.2 DUF1091 85..166 CDD:284008 23/84 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 52 1.000 Domainoid score I18610
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000262
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR20898
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
44.010

Return to query results.
Submit another query.