DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG33721 and CG33700

DIOPT Version :10

Sequence 1:NP_001036743.1 Gene:CG33721 / 3885576 FlyBaseID:FBgn0053721 Length:181 Species:Drosophila melanogaster
Sequence 2:NP_001027121.3 Gene:CG33700 / 3772390 FlyBaseID:FBgn0053700 Length:175 Species:Drosophila melanogaster


Alignment Length:157 Identity:43/157 - (27%)
Similarity:73/157 - (46%) Gaps:7/157 - (4%)


- Green bases have known domain annotations that are detailed below.


  Fly    22 ASKLEFTNFKCHVKDPTYLSFEYCFIKSVNRTYKYISLKANMYEVPITNASAKLQISRRFRSYMP 86
            |...:..|..|...|....:|..|.:|.:.|......:...:|.|||.:....:.:.::...|.|
  Fly    20 AGDFQLQNVICESFDNAITNFSRCEMKFIRRGVAAFYMVWKLYNVPIKSVDINVALYKKSNGYRP 84

  Fly    87 ITIAASIDVCKYMAYKKNLANPMLRLFEEITKKYTNTNHKCPYDHDLIIDRLPSKYLSEHFTNIL 151
            .....::|.|.||  :...|:|::.:..::..:.:|.||.|||||||||:....|   ::....|
  Fly    85 FLFNQTLDFCYYM--RNPRAHPLIYMMHKVFMQASNINHSCPYDHDLIINEFIYK---KNDLKDL 144

  Fly   152 PLPPGDYSFN-SIWYSRNIERATISIY 177
            |:|.|||... .:.:.:.. |.:|.||
  Fly   145 PIPNGDYMIRVKVAFDKEY-RTSIKIY 170

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG33721NP_001036743.1 DUF1091 74..160 CDD:461928 27/85 (32%)
CG33700NP_001027121.3 DUF1091 71..153 CDD:461928 27/86 (31%)

Return to query results.
Submit another query.