DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG33721 and CG33752

DIOPT Version :10

Sequence 1:NP_001036743.1 Gene:CG33721 / 3885576 FlyBaseID:FBgn0053721 Length:181 Species:Drosophila melanogaster
Sequence 2:NP_001027409.1 Gene:CG33752 / 3771860 FlyBaseID:FBgn0053752 Length:185 Species:Drosophila melanogaster


Alignment Length:185 Identity:47/185 - (25%)
Similarity:81/185 - (43%) Gaps:19/185 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly     9 FVLVIFFGNI-----MENASKLEFTNFKCHVKDPTYLSFEYCFIKSVNRTYKYISLKANMYEVPI 68
            |:::..|..|     :...|....||.||.|.|.::..|..|.:..:.|.....|:.....::||
  Fly     3 FIIIRVFCTITLSLEINGESITRHTNVKCEVLDKSFAEFPVCKLNVLGRGIIAESVYMKFLKLPI 67

  Fly    69 TNASAKLQISRRFRSYMPITIAASIDVCKYMAYKKNLANPM--LRLFEEITKKYTNTNHKCPYD- 130
            ...|....:.::...|.|.....::|.|.||.:    .|||  ...|....|.|:|.||.|||: 
  Fly    68 KKISVNFTVYKKLSGYHPFLFNVTVDFCHYMKH----PNPMNIFHYFYTAVKPYSNFNHSCPYNV 128

  Fly   131 ----HDLIIDRLPSKYLSEHFTNILPLPPGDYSFNSIWYSRNIERATISIYYTVS 181
                ||:::...   .|::.....:|||.|:|.|:....:.::.|..::.|:.|:
  Fly   129 SESYHDILVKDF---VLTDTMFAKIPLPTGNYMFSIKLATDDVWRVVLNTYFDVN 180

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG33721NP_001036743.1 DUF1091 74..160 CDD:461928 26/92 (28%)
CG33752NP_001027409.1 DUF1091 72..159 CDD:461928 26/93 (28%)

Return to query results.
Submit another query.