DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG33721 and CG14491

DIOPT Version :9

Sequence 1:NP_001036743.1 Gene:CG33721 / 3885576 FlyBaseID:FBgn0053721 Length:181 Species:Drosophila melanogaster
Sequence 2:NP_611276.1 Gene:CG14491 / 37046 FlyBaseID:FBgn0034284 Length:166 Species:Drosophila melanogaster


Alignment Length:148 Identity:34/148 - (22%)
Similarity:68/148 - (45%) Gaps:24/148 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly    27 FTNFKCHVKDPT-YLSFEYCFI-KSVNRTYKYISLKANMYEVPITN--ASAKLQISRRFRSYMPI 87
            |||..|..:||. .||...|.: |||.|....|.|:   ::.|:..  .:.::.:.|||.....:
  Fly     3 FTNCSCSSEDPEGMLSLLKCGLSKSVKRPSFNIELQ---FKKPVAKFFVNMRIVLPRRFGDDFTL 64

  Fly    88 TIAASIDVCKYMAYKKNLANPMLRLFEEITKKYTNTNHKCPYDHDLIIDRLPSKYLSEHFTNILP 152
            ...:.||.|..::.|..:|  .::|..:...:::|...:||:..|:      :.|:....:::..
  Fly    65 FNLSGIDGCSLLSNKNQIA--FIQLGRKHMDRFSNIPKRCPWPKDV------NYYIRGFRSDMAT 121

  Fly   153 LPPGDYSFN-----SIWY 165
            :|    :||     ::|:
  Fly   122 MP----AFNFETDMNLWF 135

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG33721NP_001036743.1 DUF1091 74..160 CDD:284008 15/85 (18%)
CG14491NP_611276.1 DM8 60..150 CDD:214778 15/88 (17%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR20898
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.