DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG33721 and CG14492

DIOPT Version :10

Sequence 1:NP_001036743.1 Gene:CG33721 / 3885576 FlyBaseID:FBgn0053721 Length:181 Species:Drosophila melanogaster
Sequence 2:NP_611275.2 Gene:CG14492 / 37045 FlyBaseID:FBgn0034283 Length:199 Species:Drosophila melanogaster


Alignment Length:142 Identity:34/142 - (23%)
Similarity:63/142 - (44%) Gaps:19/142 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MYSKAAKLFVLVIFFGNI--------MENASKLEFTNFKCHVKD--PTYLSFEYCFI-KSVNRTY 54
            |..|.|: |.:|||...:        .:|..:|:..||.|...|  .:.|....|.| ||..|..
  Fly     3 MKPKTAE-FWMVIFLYLLPNWKLEAEAKNNFELQTDNFTCSSDDISSSVLKEFTCGISKSTKRRT 66

  Fly    55 KYISLKANMYEVPITNASAKLQISRRFRSYMP--ITIAASIDVCKYMAYKKNLANPMLRLFEEIT 117
            .::..   :.|.|:......::|....|..:|  :.:..:.|.|:.:|.:..:  |::||...|.
  Fly    67 WHMEF---VLEQPVAEHDFFIKIVLPRRRPLPDFVLLNVTTDGCQLLANRNQV--PLMRLGRNIM 126

  Fly   118 KKYTNTNHKCPY 129
            ::::|...:||:
  Fly   127 ERFSNFPKQCPF 138

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG33721NP_001036743.1 DUF1091 74..160 CDD:461928 13/58 (22%)
CG14492NP_611275.2 DM8 95..186 CDD:214778 11/46 (24%)

Return to query results.
Submit another query.