DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG33721 and CG33137

DIOPT Version :9

Sequence 1:NP_001036743.1 Gene:CG33721 / 3885576 FlyBaseID:FBgn0053721 Length:181 Species:Drosophila melanogaster
Sequence 2:NP_788343.3 Gene:CG33137 / 36449 FlyBaseID:FBgn0053137 Length:193 Species:Drosophila melanogaster


Alignment Length:158 Identity:37/158 - (23%)
Similarity:71/158 - (44%) Gaps:31/158 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly    29 NFKCHVKDPTYLSFEYCFIKSVNRTYKYISLKANMYEV-PITNASAKLQISRRFRS--YMPITIA 90
            |.:|... |.:.:...|.|:::|  :.....:.::|.: |:.|.:.:.||.::..|  :.|..:.
  Fly    18 NIECSTV-PGFSANASCHIRAIN--WNKAVAEMDVYLLRPLYNITIRFQILKKDYSNKFQPFLVD 79

  Fly    91 ASIDVCKYMAYKKNLANPMLRLFEEITKKYTNTNHKCPYDHDLIIDRLPSKYLSE-HFTNILPLP 154
            ..|::|..::.:..:...::.|  :|.:.::|.||.|||...|:   ....||:| :..|:.|| 
  Fly    80 VVINMCDALSRRSFIPYGLIIL--KIARTFSNFNHSCPYRGHLM---ARGAYLNESYLPNVFPL- 138

  Fly   155 PGDYSFN-----------------SIWY 165
             |.|.||                 .|||
  Fly   139 -GFYKFNITIMENYITPPSAHVGGIIWY 165

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG33721NP_001036743.1 DUF1091 74..160 CDD:284008 23/88 (26%)
CG33137NP_788343.3 DM8 73..164 CDD:214778 22/97 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR20898
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X90
33.010

Return to query results.
Submit another query.