DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG33721 and CG33137

DIOPT Version :10

Sequence 1:NP_001036743.1 Gene:CG33721 / 3885576 FlyBaseID:FBgn0053721 Length:181 Species:Drosophila melanogaster
Sequence 2:NP_788343.3 Gene:CG33137 / 36449 FlyBaseID:FBgn0053137 Length:193 Species:Drosophila melanogaster


Alignment Length:158 Identity:37/158 - (23%)
Similarity:71/158 - (44%) Gaps:31/158 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly    29 NFKCHVKDPTYLSFEYCFIKSVNRTYKYISLKANMYEV-PITNASAKLQISRRFRS--YMPITIA 90
            |.:|... |.:.:...|.|:::|  :.....:.::|.: |:.|.:.:.||.::..|  :.|..:.
  Fly    18 NIECSTV-PGFSANASCHIRAIN--WNKAVAEMDVYLLRPLYNITIRFQILKKDYSNKFQPFLVD 79

  Fly    91 ASIDVCKYMAYKKNLANPMLRLFEEITKKYTNTNHKCPYDHDLIIDRLPSKYLSE-HFTNILPLP 154
            ..|::|..::.:..:...::.|  :|.:.::|.||.|||...|:   ....||:| :..|:.|| 
  Fly    80 VVINMCDALSRRSFIPYGLIIL--KIARTFSNFNHSCPYRGHLM---ARGAYLNESYLPNVFPL- 138

  Fly   155 PGDYSFN-----------------SIWY 165
             |.|.||                 .|||
  Fly   139 -GFYKFNITIMENYITPPSAHVGGIIWY 165

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG33721NP_001036743.1 DUF1091 74..160 CDD:461928 23/88 (26%)
CG33137NP_788343.3 DM8 73..164 CDD:214778 22/97 (23%)

Return to query results.
Submit another query.