DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG33721 and CG30050

DIOPT Version :9

Sequence 1:NP_001036743.1 Gene:CG33721 / 3885576 FlyBaseID:FBgn0053721 Length:181 Species:Drosophila melanogaster
Sequence 2:NP_725159.2 Gene:CG30050 / 246417 FlyBaseID:FBgn0050050 Length:192 Species:Drosophila melanogaster


Alignment Length:169 Identity:41/169 - (24%)
Similarity:64/169 - (37%) Gaps:51/169 - (30%)


- Green bases have known domain annotations that are detailed below.


  Fly    25 LEFTNFKCHVKDPTYLSFEYC-FIKSVNRT-------YKYISLKANMYEVPITNASAKLQISRRF 81
            :|.....| |.:|.|.:..|| .|...|||       .:.:|:.:....|.|.|  ||..|::.|
  Fly    31 IEMKQMDC-VGNPNYFANLYCRIIPPKNRTMEASVNIMQQLSVFSGSLRVSIPN--AKKVITQIF 92

  Fly    82 RSYMPITIAASIDVCKYMAYKKN------LANPMLRLFEEITKKYTNTNHK---CPY------DH 131
                .||    .||||.:..:|.      |.|.:.:          |:|.|   ||:      ..
  Fly    93 ----DIT----FDVCKVLRERKRKILIDLLVNTLAK----------NSNAKAWRCPFPKGKFESR 139

  Fly   132 DLIIDRLPSKYL-SEHFTNILPLPPGDYSFNSIWYSRNI 169
            ::.:..||.... ||.|.|:      |:....:..:.|:
  Fly   140 NISVTDLPPMLTESEFFVNL------DFFIPKVAIAMNV 172

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG33721NP_001036743.1 DUF1091 74..160 CDD:284008 24/101 (24%)
CG30050NP_725159.2 DM8 90..177 CDD:214778 23/107 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR20898
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.