DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG33977 and DPMS3

DIOPT Version :9

Sequence 1:NP_001034051.1 Gene:CG33977 / 3885575 FlyBaseID:FBgn0053977 Length:94 Species:Drosophila melanogaster
Sequence 2:NP_564521.1 Gene:DPMS3 / 841232 AraportID:AT1G48140 Length:89 Species:Arabidopsis thaliana


Alignment Length:67 Identity:21/67 - (31%)
Similarity:32/67 - (47%) Gaps:2/67 - (2%)


- Green bases have known domain annotations that are detailed below.


  Fly    23 LGTVQTPLTTKYFLHIQLLPLLLLVIFGIYSVWTVLYRTLTFNDCPEAAKELQDEIQEARKDLIA 87
            :|.:|..:..:  .|..|||:..:|..|.|.:..|....:.|..||:.|..||.:|.||:.....
plant    19 IGLLQAAIIPR--SHTWLLPIYFVVSLGCYGLLMVGVGLMQFPTCPQEAVLLQKDIAEAKDFFKH 81

  Fly    88 KG 89
            ||
plant    82 KG 83

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG33977NP_001034051.1 DPM3 7..91 CDD:285485 21/67 (31%)
DPMS3NP_564521.1 DPM3 1..84 CDD:400538 21/67 (31%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1612544at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_104618
Panther 1 1.100 - - LDO PTHR16433
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
65.880

Return to query results.
Submit another query.