powered by:
Protein Alignment CG33977 and DPMS3
DIOPT Version :9
Sequence 1: | NP_001034051.1 |
Gene: | CG33977 / 3885575 |
FlyBaseID: | FBgn0053977 |
Length: | 94 |
Species: | Drosophila melanogaster |
Sequence 2: | NP_564521.1 |
Gene: | DPMS3 / 841232 |
AraportID: | AT1G48140 |
Length: | 89 |
Species: | Arabidopsis thaliana |
Alignment Length: | 67 |
Identity: | 21/67 - (31%) |
Similarity: | 32/67 - (47%) |
Gaps: | 2/67 - (2%) |
- Green bases have known domain annotations that are detailed below.
Fly 23 LGTVQTPLTTKYFLHIQLLPLLLLVIFGIYSVWTVLYRTLTFNDCPEAAKELQDEIQEARKDLIA 87
:|.:|..:..: .|..|||:..:|..|.|.:..|....:.|..||:.|..||.:|.||:.....
plant 19 IGLLQAAIIPR--SHTWLLPIYFVVSLGCYGLLMVGVGLMQFPTCPQEAVLLQKDIAEAKDFFKH 81
Fly 88 KG 89
||
plant 82 KG 83
|
Known Domains:
Indicated by green bases in alignment.
Gene | Sequence | Domain | Region |
External ID | Identity |
CG33977 | NP_001034051.1 |
DPM3 |
7..91 |
CDD:285485 |
21/67 (31%) |
DPMS3 | NP_564521.1 |
DPM3 |
1..84 |
CDD:400538 |
21/67 (31%) |
Information from Original Tools:
Tool |
Simple Score |
Weighted Score |
Original Tool Information |
BLAST Result |
Score |
Score Type |
Cluster ID |
Domainoid |
0 | 0.000 |
Not matched by this tool. |
eggNOG |
0 | 0.000 |
Not matched by this tool. |
Hieranoid |
1 |
1.000 |
- |
- |
|
|
Homologene |
0 | 0.000 |
Not matched by this tool. |
Inparanoid |
0 | 0.000 |
Not matched by this tool. |
OMA |
0 | 0.000 |
Not matched by this tool. |
OrthoDB |
1 |
1.010 |
- |
- |
|
D1612544at2759 |
OrthoFinder |
0 | 0.000 |
Not matched by this tool. |
OrthoInspector |
0 | 0.000 |
Not matched by this tool. |
orthoMCL |
1 |
0.900 |
- |
- |
|
OOG6_104618 |
Panther |
1 |
1.100 |
- |
- |
LDO |
PTHR16433 |
Phylome |
1 |
0.910 |
- |
- |
|
|
SonicParanoid |
0 | 0.000 |
Not matched by this tool. |
SwiftOrtho |
0 | 0.000 |
Not matched by this tool. |
TreeFam |
1 |
0.960 |
- |
- |
|
|
|
6 | 5.880 |
|
Return to query results.
Submit another query.