DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG33977 and DPM3

DIOPT Version :9

Sequence 1:NP_001034051.1 Gene:CG33977 / 3885575 FlyBaseID:FBgn0053977 Length:94 Species:Drosophila melanogaster
Sequence 2:NP_061846.2 Gene:DPM3 / 54344 HGNCID:3007 Length:122 Species:Homo sapiens


Alignment Length:94 Identity:39/94 - (41%)
Similarity:58/94 - (61%) Gaps:4/94 - (4%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MTNLQRWLFYASLFAIPYLSVVLGT--VQTPLTTKYFLHIQLLPLLLLVIFGIYSVWTVLYRTLT 63
            ||.|.:||:..::....::::..|.  ::.||:.:..|  ..||..|||..|.|::.||.||..|
Human    31 MTKLAQWLWGLAILGSTWVALTTGALGLELPLSCQEVL--WPLPAYLLVSAGCYALGTVGYRVAT 93

  Fly    64 FNDCPEAAKELQDEIQEARKDLIAKGFRF 92
            |:||.:||:|||.:|||||.||..:|.||
Human    94 FHDCEDAARELQSQIQEARADLARRGLRF 122

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG33977NP_001034051.1 DPM3 7..91 CDD:285485 34/85 (40%)
DPM3NP_061846.2 DPM3 37..121 CDD:311956 34/85 (40%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165142882
Domainoid 1 1.000 66 1.000 Domainoid score I10012
eggNOG 1 0.900 - - E1_KOG4841
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 69 1.000 Inparanoid score I5326
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG46778
OrthoDB 1 1.010 - - D1612544at2759
OrthoFinder 1 1.000 - - FOG0006200
OrthoInspector 1 1.000 - - oto90314
orthoMCL 1 0.900 - - OOG6_104618
Panther 1 1.100 - - LDO PTHR16433
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R5046
SonicParanoid 1 1.000 - - X5928
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
User_Submission 00.000 Not matched by this tool.
1514.800

Return to query results.
Submit another query.