DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG33977 and Dpm3

DIOPT Version :9

Sequence 1:NP_001034051.1 Gene:CG33977 / 3885575 FlyBaseID:FBgn0053977 Length:94 Species:Drosophila melanogaster
Sequence 2:NP_001102801.1 Gene:Dpm3 / 502017 RGDID:1561807 Length:92 Species:Rattus norvegicus


Alignment Length:94 Identity:40/94 - (42%)
Similarity:56/94 - (59%) Gaps:4/94 - (4%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MTNLQRWLFYASLFAIPYLSVVLGT--VQTPLTTKYFLHIQLLPLLLLVIFGIYSVWTVLYRTLT 63
            ||.|.:||:..:|....:.::.:|.  ::.||..:..|  ..||..|||..|.|::.||.||..|
  Rat     1 MTKLTQWLWGLALLGSAWAALTMGALGLELPLPCREVL--WPLPAYLLVSAGCYALGTVGYRVAT 63

  Fly    64 FNDCPEAAKELQDEIQEARKDLIAKGFRF 92
            |:||.:||:|||.:|.|||.||..||.||
  Rat    64 FHDCEDAARELQSQILEARADLARKGLRF 92

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG33977NP_001034051.1 DPM3 7..91 CDD:285485 35/85 (41%)
Dpm3NP_001102801.1 DPM3 1..90 CDD:400538 37/90 (41%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C166336584
Domainoid 1 1.000 65 1.000 Domainoid score I9809
eggNOG 1 0.900 - - E1_KOG4841
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 69 1.000 Inparanoid score I5230
OMA 1 1.010 - - QHG46778
OrthoDB 1 1.010 - - D1612544at2759
OrthoFinder 1 1.000 - - FOG0006200
OrthoInspector 1 1.000 - - oto97433
orthoMCL 1 0.900 - - OOG6_104618
Panther 1 1.100 - - LDO PTHR16433
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X5928
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
1413.770

Return to query results.
Submit another query.