DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG33977 and dpm3

DIOPT Version :9

Sequence 1:NP_001034051.1 Gene:CG33977 / 3885575 FlyBaseID:FBgn0053977 Length:94 Species:Drosophila melanogaster
Sequence 2:NP_596640.1 Gene:dpm3 / 2539664 PomBaseID:SPBC1677.02 Length:90 Species:Schizosaccharomyces pombe


Alignment Length:89 Identity:32/89 - (35%)
Similarity:44/89 - (49%) Gaps:9/89 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly     8 LFYASLFAIPYLSVVLGTVQTPLTT--KYFLHIQLLPLLLLVIFGIYSVWTVLYRTLTFNDCPEA 70
            |:|.|| .|.|....|..::.|.:|  .|      .|.|.::.||.|...|:||...|.||.|||
pombe     9 LYYVSL-TILYRVTYLFDLEEPWSTLRPY------TPYLFILAFGSYLGITLLYNVATTNDKPEA 66

  Fly    71 AKELQDEIQEARKDLIAKGFRFRD 94
            ..:|..:|:||:..|.:||....|
pombe    67 YVDLVKDIKEAQDALRSKGMTIED 90

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG33977NP_001034051.1 DPM3 7..91 CDD:285485 31/84 (37%)
dpm3NP_596640.1 DPM3 7..87 CDD:285485 31/84 (37%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG4841
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0006200
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_104618
Panther 1 1.100 - - LDO PTHR16433
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R5046
SonicParanoid 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
87.800

Return to query results.
Submit another query.