DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG33977 and dpm-3

DIOPT Version :9

Sequence 1:NP_001034051.1 Gene:CG33977 / 3885575 FlyBaseID:FBgn0053977 Length:94 Species:Drosophila melanogaster
Sequence 2:NP_502366.1 Gene:dpm-3 / 178189 WormBaseID:WBGene00009219 Length:95 Species:Caenorhabditis elegans


Alignment Length:90 Identity:30/90 - (33%)
Similarity:45/90 - (50%) Gaps:2/90 - (2%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MTNLQRWLFYASLFAIPYLSVVLGTVQTPLTTKYFLH--IQLLPLLLLVIFGIYSVWTVLYRTLT 63
            ::.|..:..:..||.:.:|......|.........||  :...|...::..|||:|:.|:|...|
 Worm     2 VSQLVTYSAHVILFVLVWLLAYTDVVPVLSYLPECLHCLVNYAPFFAVLFLGIYAVFNVVYGVAT 66

  Fly    64 FNDCPEAAKELQDEIQEARKDLIAK 88
            ||||.||..||..||:|||::|..|
 Worm    67 FNDCAEAKVELLGEIKEAREELKRK 91

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG33977NP_001034051.1 DPM3 7..91 CDD:285485 29/84 (35%)
dpm-3NP_502366.1 DPM3 10..91 CDD:285485 28/80 (35%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C160157386
Domainoid 1 1.000 49 1.000 Domainoid score I7989
eggNOG 1 0.900 - - E1_KOG4841
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 50 1.000 Inparanoid score I4111
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1612544at2759
OrthoFinder 1 1.000 - - FOG0006200
OrthoInspector 1 1.000 - - oto19372
orthoMCL 1 0.900 - - OOG6_104618
Panther 1 1.100 - - LDO PTHR16433
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R5046
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
1312.790

Return to query results.
Submit another query.