DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Octbeta3R and TAAR2

DIOPT Version :9

Sequence 1:NP_001034048.2 Gene:Octbeta3R / 3885573 FlyBaseID:FBgn0250910 Length:1256 Species:Drosophila melanogaster
Sequence 2:NP_001028252.1 Gene:TAAR2 / 9287 HGNCID:4514 Length:351 Species:Homo sapiens


Alignment Length:266 Identity:70/266 - (26%)
Similarity:118/266 - (44%) Gaps:21/266 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly    83 ATSSDASYSSPFSSYLSSDSTFELLSTVGPNITANGSDIAVDNQAELEESWLDLSLLLLKGFIFS 147
            |.||:....|.|....:....|        |.:..|:....:|:..|...      :.:..|:..
Human     2 AVSSEQHELSHFKRTQTKKEKF--------NCSEYGNRSCPENERSLGVR------VAMYSFMAG 52

  Fly   148 SIILAAVLGNALVIISVQRNRKLRVITNYFVVSLAMADMLVALCAMTFN--ASVELSGGKWMFGP 210
            ||.: .:.||..:|||:...::|...||:.::|:|:.|.|:....|.::  .|||   ..|.||.
Human    53 SIFI-TIFGNLAMIISISYFKQLHTPTNFLILSMAITDFLLGFTIMPYSMIRSVE---NCWYFGL 113

  Fly   211 FMCNVYNSLDVYFSTASILHLCCISVDRYYAIVRPLEYPLNMTHKTVCFMLANVWILPALISFTP 275
            ..|.:|.|.|:..|..||.|||.:::||:|||..||.|...:|...:..:|...|.:|...:|..
Human   114 TFCKIYYSFDLMLSITSIFHLCSVAIDRFYAICYPLLYSTKITIPVIKRLLLLCWSVPGAFAFGV 178

  Fly   276 IFLGWYTTEEHLREISLH-PDQCSFVVNKAYALISSSVSFWIPGIVMLVMYWRIFKEAIRQRKAL 339
            :|...|.......:|.:. ...|..:.||.:........|:.||.:|:.:|.:||..:.:...|:
Human   179 VFSEAYADGIEGYDILVACSSSCPVMFNKLWGTTLFMAGFFTPGSMMVGIYGKIFAVSRKHAHAI 243

  Fly   340 SRTSSN 345
            :....|
Human   244 NNLREN 249

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Octbeta3RNP_001034048.2 7tm_4 146..>346 CDD:304433 59/203 (29%)
7tm_1 156..>344 CDD:278431 56/190 (29%)
TAAR2NP_001028252.1 7tm_4 53..>180 CDD:304433 44/130 (34%)
7tm_1 60..315 CDD:278431 57/193 (30%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.