Sequence 1: | NP_001034048.2 | Gene: | Octbeta3R / 3885573 | FlyBaseID: | FBgn0250910 | Length: | 1256 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_001376456.1 | Gene: | TAAR5 / 9038 | HGNCID: | 30236 | Length: | 337 | Species: | Homo sapiens |
Alignment Length: | 202 | Identity: | 66/202 - (32%) |
---|---|---|---|
Similarity: | 107/202 - (52%) | Gaps: | 11/202 - (5%) |
- Green bases have known domain annotations that are detailed below.
Fly 150 ILAAVLGNALVIISVQRNRKLRVITNYFVVSLAMADMLVALCAMTFNA--SVELSGGKWMFGPFM 212
Fly 213 CNVYNSLDVYFSTASILHLCCISVDRYYAIVRPLEYPLNMTHKTVCFMLANVWILPALISFTPIF 277
Fly 278 LGWYTTEEHLRE-ISLHP--DQCSFVVNKAYALISSSVSFWIPGIVMLVMYWRIFKEAIRQRKAL 339
Fly 340 SRTSSNI 346 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
Octbeta3R | NP_001034048.2 | 7tm_4 | 146..>346 | CDD:304433 | 66/200 (33%) |
7tm_1 | 156..>344 | CDD:278431 | 62/192 (32%) | ||
TAAR5 | NP_001376456.1 | 7tmA_TAAR5 | 35..316 | CDD:320441 | 66/202 (33%) |
TM helix 1 | 37..61 | CDD:320441 | 7/15 (47%) | ||
TM helix 2 | 70..92 | CDD:320441 | 8/21 (38%) | ||
TM helix 3 | 108..130 | CDD:320441 | 9/21 (43%) | ||
TM helix 4 | 153..169 | CDD:320441 | 4/17 (24%) | ||
TM helix 5 | 197..220 | CDD:320441 | 5/23 (22%) | ||
TM helix 6 | 251..273 | CDD:320441 | |||
TM helix 7 | 284..309 | CDD:320441 | |||
Blue background indicates that the domain is not in the aligned region. |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 0 | 0.000 | Not matched by this tool. | |||
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
Isobase | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 1 | 0.910 | - | - | ||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 1 | 1.000 | - | - | ||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
User_Submission | 0 | 0.000 | Not matched by this tool. | |||
2 | 1.910 |