DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Octbeta3R and TAAR8

DIOPT Version :9

Sequence 1:NP_001034048.2 Gene:Octbeta3R / 3885573 FlyBaseID:FBgn0250910 Length:1256 Species:Drosophila melanogaster
Sequence 2:NP_444508.1 Gene:TAAR8 / 83551 HGNCID:14964 Length:342 Species:Homo sapiens


Alignment Length:212 Identity:71/212 - (33%)
Similarity:111/212 - (52%) Gaps:9/212 - (4%)


- Green bases have known domain annotations that are detailed below.


  Fly   138 LLLLKGFIFSSIILAAVLGNALVIISVQRNRKLRVITNYFVVSLAMADMLVALCAMTFNASVELS 202
            ::|...|.|.|::  ||.||.||:.||...::|...||:.:.|||.||.||.:..|.| :.|...
Human    32 VILYTAFSFGSLL--AVFGNLLVMTSVLHFKQLHSPTNFLIASLACADFLVGVTVMLF-SMVRTV 93

  Fly   203 GGKWMFGPFMCNVYNSLDVYFSTASILHLCCISVDRYYAIVRPLEYPLNMTHKTVCFMLANVWIL 267
            ...|.||...|.:::..||.|..:|:||||.|.:|||..:..||.|....|.......::..|||
Human    94 ESCWYFGAKFCTLHSCCDVAFCYSSVLHLCFICIDRYIVVTDPLVYATKFTVSVSGICISVSWIL 158

  Fly   268 PALISFTPIFLGWYTTEEHLREI--SLH-PDQCSFVVNKAYALISSSVSFWIPGIVMLVMYWRIF 329
            |...|....:.|  ..::.|.|:  :|: ...|..:|::.:.|| ..:.|:||.:||:::|.:||
Human   159 PLTYSGAVFYTG--VNDDGLEELVSALNCVGGCQIIVSQGWVLI-DFLLFFIPTLVMIILYSKIF 220

  Fly   330 KEAIRQRKALSRTSSNI 346
            ..|.:|...:..|||.:
Human   221 LIAKQQAIKIETTSSKV 237

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Octbeta3RNP_001034048.2 7tm_4 146..>346 CDD:304433 69/202 (34%)
7tm_1 156..>344 CDD:278431 63/190 (33%)
TAAR8NP_444508.1 7tm_1 48..310 CDD:278431 65/194 (34%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.