DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Octbeta3R and taar12g

DIOPT Version :9

Sequence 1:NP_001034048.2 Gene:Octbeta3R / 3885573 FlyBaseID:FBgn0250910 Length:1256 Species:Drosophila melanogaster
Sequence 2:NP_001076377.1 Gene:taar12g / 794997 ZFINID:ZDB-GENE-041014-64 Length:336 Species:Danio rerio


Alignment Length:240 Identity:78/240 - (32%)
Similarity:117/240 - (48%) Gaps:24/240 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly   104 FELLSTVGPNITANGSDIAVDNQAELEESWLDLSLLLLKGFIFSSIILAAVLGNALVIISVQRNR 168
            :.|||...|.:          ::..:.:..|.:.|||:        ||..|.||.|:|||:...:
Zfish    13 YPLLSNSCPKL----------HRLAVVQVGLYICLLLM--------ILTTVFGNLLIIISISHFK 59

  Fly   169 KLRVITNYFVVSLAMADMLVALCAMTFNASVELSGGKWMFGPFMCNVYNSLDVYFSTASILHLCC 233
            .|:..|:..|.|||..|.|:....|. |:.|....|.|..|..:|.|::|||:....:|:|||..
Zfish    60 HLQSPTHLIVRSLAACDCLLGSLVMP-NSMVRSVEGCWYLGDVVCKVHSSLDMTLCISSLLHLGL 123

  Fly   234 ISVDRYYAIVRPLEYPLNMTHKTVCFMLANVWILPALISFTPIFLGWYTTEEHLREISLHP---D 295
            ||||||.||..||.|.:.:|:.||......:|:...:.||...|.|  .|...|..:.|..   .
Zfish   124 ISVDRYLAICDPLRYRIRVTNTTVTVFTVFIWLFSVVYSFYVKFSG--ITAVGLEMLILQTYCVG 186

  Fly   296 QCSFVVNKAYALISSSVSFWIPGIVMLVMYWRIFKEAIRQRKALS 340
            :|....||.:.||...::|::||.:|..:|.:||..|.:|.|.:|
Zfish   187 RCVVFFNKQWGLICPVLAFFLPGAIMSSLYMKIFHVARKQAKVIS 231

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Octbeta3RNP_001034048.2 7tm_4 146..>346 CDD:304433 70/198 (35%)
7tm_1 156..>344 CDD:278431 67/188 (36%)
taar12gNP_001076377.1 7tm_4 45..317 CDD:304433 68/190 (36%)
7tm_1 47..305 CDD:278431 67/188 (36%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
11.000

Return to query results.
Submit another query.