Sequence 1: | NP_001034048.2 | Gene: | Octbeta3R / 3885573 | FlyBaseID: | FBgn0250910 | Length: | 1256 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_001076376.1 | Gene: | taar12f / 794923 | ZFINID: | ZDB-GENE-041014-98 | Length: | 337 | Species: | Danio rerio |
Alignment Length: | 196 | Identity: | 71/196 - (36%) |
---|---|---|---|
Similarity: | 107/196 - (54%) | Gaps: | 8/196 - (4%) |
- Green bases have known domain annotations that are detailed below.
Fly 149 IILAAVLGNALVIISVQRNRKLRVITNYFVVSLAMADMLVALCAMTFN--ASVELSGGKWMFGPF 211
Fly 212 MCNVYNSLDVYFSTASILHLCCISVDRYYAIVRPLEYPLNMTHKTVCFMLANVWILPALISFTPI 276
Fly 277 FLGWYTT--EEHLREISLHPDQCSFVVNKAYALISSSVSFWIPGIVMLVMYWRIFKEAIRQRKAL 339
Fly 340 S 340 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
Octbeta3R | NP_001034048.2 | 7tm_4 | 146..>346 | CDD:304433 | 71/196 (36%) |
7tm_1 | 156..>344 | CDD:278431 | 68/189 (36%) | ||
taar12f | NP_001076376.1 | 7tm_4 | 48..320 | CDD:304433 | 69/191 (36%) |
7tm_1 | 50..308 | CDD:278431 | 68/189 (36%) |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 0 | 0.000 | Not matched by this tool. | |||
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 0 | 0.000 | Not matched by this tool. | |||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
ZFIN | 0 | 0.000 | Not matched by this tool. | |||
0 | 0.000 |