DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Octbeta3R and taar1b

DIOPT Version :9

Sequence 1:NP_001034048.2 Gene:Octbeta3R / 3885573 FlyBaseID:FBgn0250910 Length:1256 Species:Drosophila melanogaster
Sequence 2:NP_001076373.1 Gene:taar1b / 794715 ZFINID:ZDB-GENE-041014-58 Length:332 Species:Danio rerio


Alignment Length:203 Identity:65/203 - (32%)
Similarity:105/203 - (51%) Gaps:23/203 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly   149 IILAAVLGNALVIISVQRNRKLRVITNYFVVSLAMADMLVALCAMTFNASVELSGGKWMFGPFMC 213
            ||....:||.|||||:...|:|...||..::|||:.|.|:.|..|..:| |....|.|.||.|:|
Zfish    32 IISMTFIGNLLVIISIGHFRQLHTPTNQLILSLALCDFLIGLFVMPLSA-VRSMQGCWYFGEFLC 95

  Fly   214 NVYNSLDVYFSTASILHLCCISVDRYYAIVRPLEYPLNMTHKTVCFMLANVWILPALISFTPIFL 278
            .::..:|:..||:||.||..:|.:|:.|:..||.|.......||..|::..|::|.:.::...||
Zfish    96 KLHTCIDITLSTSSIFHLVSVSAERFCAVCGPLRYRSCFGLSTVLLMISISWLIPGIFAYVMTFL 160

  Fly   279 GWYTTEEHLREISLHPDQ------------CSFVVNKAYALISSSVSFWIPGIVMLVMYWRIFKE 331
                      ||::|..:            |....:...|:.:|..||:|||.:::|:|.||:..
Zfish   161 ----------EINIHGGKDFYDAHVRCVGGCHVFFSHGPAVFTSVFSFYIPGFIIVVIYSRIYMV 215

  Fly   332 AIRQRKAL 339
            |..|.:::
Zfish   216 ARNQERSI 223

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Octbeta3RNP_001034048.2 7tm_4 146..>346 CDD:304433 65/203 (32%)
7tm_1 156..>344 CDD:278431 63/196 (32%)
taar1bNP_001076373.1 7tm_4 31..>159 CDD:304433 46/127 (36%)
7tm_1 39..301 CDD:278431 63/196 (32%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
11.000

Return to query results.
Submit another query.