DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Octbeta3R and taar11

DIOPT Version :9

Sequence 1:NP_001034048.2 Gene:Octbeta3R / 3885573 FlyBaseID:FBgn0250910 Length:1256 Species:Drosophila melanogaster
Sequence 2:NP_001076546.1 Gene:taar11 / 794647 ZFINID:ZDB-GENE-041014-52 Length:327 Species:Danio rerio


Alignment Length:231 Identity:64/231 - (27%)
Similarity:110/231 - (47%) Gaps:36/231 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly   145 IFSSIILAAVLGNALVIISVQRNRKLRVITNYFVVSLAMADMLVALCAM--TFNASVELSGGKWM 207
            :|...|:..|.||..||.::...::|...|||.::|:|::|:|:....|  :...|:|..   |.
Zfish    40 LFIIAIILIVFGNLWVICTISFFQQLHTPTNYLILSMAVSDLLLGSFVMPPSMLRSLETC---WY 101

  Fly   208 FGPFMCNVYNSLDVYFSTASILHLCCISVDRYYAIVRPLEYPLNMTHKTVCFMLANVWILPALIS 272
            ||.|.|..:::.|.....||:|||..||:|||||:.:|..|...||.:...||:...|...|...
Zfish   102 FGDFFCKFHSATDFTLCNASVLHLVFISIDRYYAVCQPFHYQSRMTTRVSVFMILISWSFSAFFG 166

  Fly   273 FTPIF----LGWYTTEE------------HLREISLHPDQCSFVVNKAYALISSSVSFWIPGIVM 321
            |..||    :....|||            |.|||.:           .|:|    |.:::|..::
Zfish   167 FGIIFSELKIEKKRTEELHVACKGGCLALHGREIGV-----------TYSL----VFYFLPMFII 216

  Fly   322 LVMYWRIFKEAIRQRKALSRTSSNILLNSVHMGHTQ 357
            :.:|.|:|..|::..:.::..:|::....:.:..|:
Zfish   217 VSLYSRVFIIALKHVRVINSAASSLSATKMDLKATK 252

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Octbeta3RNP_001034048.2 7tm_4 146..>346 CDD:304433 63/217 (29%)
7tm_1 156..>344 CDD:278431 59/205 (29%)
taar11NP_001076546.1 7tmA_TAAR1 49..313 CDD:320438 62/222 (28%)
TM helix 2 69..95 CDD:320438 8/25 (32%)
TM helix 3 107..137 CDD:320438 14/29 (48%)
TM helix 4 149..172 CDD:320438 6/22 (27%)
TM helix 5 197..226 CDD:320438 10/43 (23%)
TM helix 6 245..275 CDD:320438 1/8 (13%)
TM helix 7 284..309 CDD:320438
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
00.000

Return to query results.
Submit another query.