DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Octbeta3R and adrb3b

DIOPT Version :9

Sequence 1:NP_001034048.2 Gene:Octbeta3R / 3885573 FlyBaseID:FBgn0250910 Length:1256 Species:Drosophila melanogaster
Sequence 2:XP_021334880.1 Gene:adrb3b / 792519 ZFINID:ZDB-GENE-081022-154 Length:417 Species:Danio rerio


Alignment Length:252 Identity:80/252 - (31%)
Similarity:133/252 - (52%) Gaps:29/252 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly   149 IILAAVLGNALVIISVQRNRKLRVITNYFVVSLAMADMLVALCAMTFNASVELSGGKWMFGPFMC 213
            :|...|:||.|||:::.|...|...||.|::|:|.||:::.........|:.:: |||:.|..||
Zfish    24 VIFLTVIGNLLVILAIARTPLLHTTTNVFIISMAFADLIMGCVVQPLGLSMVVA-GKWVLGNPMC 87

  Fly   214 NVYNSLDVYFSTASILHLCCISVDRYYAIVRPLEYPLNMTHKTVCFMLANVWILPALISFTPIFL 278
            :::.||||:..||||..||.|:|:||.||.||||:.:.:..:...:::..|||:.:|:||.|| :
Zfish    88 DLWTSLDVFCVTASIETLCAIAVERYIAITRPLEHQVLLGKRRAAYIVCTVWIVSSLVSFVPI-M 151

  Fly   279 GWYTTEEHL--REISLHPDQCSFVVNKAYALISSSVSFWIPGIVMLVMYWRIFKEAIRQRKALSR 341
            ...:...:|  .:...:.:.|.|..|:.||:.||.|||::|.:||:.:|.::|..|.:|.|.:.:
Zfish   152 NHNSRANYLAANDCYNNSECCDFHTNQHYAIFSSVVSFYVPLLVMVFLYGKVFAIANKQLKLIGK 216

  Fly   342 TSSNILLNSVHMGHTQQPTSLSYLHPSDCDLNATSARE----------ETHSALSNL 388
            .....               ||..:...|::...|||.          :.|.||..|
Zfish   217 DRLRF---------------LSSCNEDSCEIPEGSARSYSRRTTKHVVKEHKALKTL 258

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Octbeta3RNP_001034048.2 7tm_4 146..>346 CDD:304433 70/198 (35%)
7tm_1 156..>344 CDD:278431 68/189 (36%)
adrb3bXP_021334880.1 7tmA_Beta_AR 25..319 CDD:320186 80/251 (32%)
TM helix 2 49..76 CDD:320186 8/26 (31%)
TM helix 3 87..117 CDD:320186 16/29 (55%)
TM helix 4 131..149 CDD:320186 6/17 (35%)
TM helix 5 177..209 CDD:320186 14/31 (45%)
TM helix 6 249..279 CDD:320186 4/10 (40%)
TM helix 7 288..313 CDD:320186
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D328277at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR24248
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
33.020

Return to query results.
Submit another query.