DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Octbeta3R and hrh2a

DIOPT Version :9

Sequence 1:NP_001034048.2 Gene:Octbeta3R / 3885573 FlyBaseID:FBgn0250910 Length:1256 Species:Drosophila melanogaster
Sequence 2:NP_001038803.2 Gene:hrh2a / 735303 ZFINID:ZDB-GENE-070531-4 Length:369 Species:Danio rerio


Alignment Length:206 Identity:80/206 - (38%)
Similarity:123/206 - (59%) Gaps:10/206 - (4%)


- Green bases have known domain annotations that are detailed below.


  Fly   147 SSIILAAVLGNALVIISVQRNRKLRVITNYFVVSLAMADMLVALCAMTFNASVELSGGKWMFGPF 211
            |.:||..|.||.||.::|...|:||.:||.|:||||:.|.|:....:.|:...::: |.|..|..
Zfish    12 SVLILLTVSGNILVCLAVYATRRLRNVTNCFIVSLAVTDFLLGALVLPFSTLYQVT-GDWPLGAH 75

  Fly   212 MCNVYNSLDVYFSTASILHLCCISVDRYYAIVRPLEYPLNMTHKTVCFMLANVWILPALISFTPI 276
            .||:|.||||...|||||:|..||:|||:|:..||.||:.:....|..:||.:|::...:||.||
Zfish    76 FCNIYISLDVMLCTASILNLFAISLDRYFAVTAPLRYPMLVLPWRVGAILATIWLVSVGVSFVPI 140

  Fly   277 FLGWYTTE---EHLREISLHPDQCSFVVNKAYALISSSVSFWIPGIVMLVMYWRIFKEA-IRQRK 337
            .|||.|.:   :::|| ..|...|.|.:|..||::.:..:|::|.:.|...|.|:|:.| :|.::
Zfish   141 HLGWNTRDLSVQNIRE-GDHARDCRFELNPTYAIVDAFSTFYLPLLAMCWSYHRVFRIARMRAKR 204

  Fly   338 ALS----RTSS 344
            .:|    .|||
Zfish   205 IISTRRGSTSS 215

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Octbeta3RNP_001034048.2 7tm_4 146..>346 CDD:304433 80/206 (39%)
7tm_1 156..>344 CDD:278431 74/195 (38%)
hrh2aNP_001038803.2 7tm_1 21..284 CDD:278431 76/197 (39%)
7tm_4 21..>112 CDD:304433 42/91 (46%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 1 1.000 - - H40613
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.