Sequence 1: | NP_001034048.2 | Gene: | Octbeta3R / 3885573 | FlyBaseID: | FBgn0250910 | Length: | 1256 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_001038803.2 | Gene: | hrh2a / 735303 | ZFINID: | ZDB-GENE-070531-4 | Length: | 369 | Species: | Danio rerio |
Alignment Length: | 206 | Identity: | 80/206 - (38%) |
---|---|---|---|
Similarity: | 123/206 - (59%) | Gaps: | 10/206 - (4%) |
- Green bases have known domain annotations that are detailed below.
Fly 147 SSIILAAVLGNALVIISVQRNRKLRVITNYFVVSLAMADMLVALCAMTFNASVELSGGKWMFGPF 211
Fly 212 MCNVYNSLDVYFSTASILHLCCISVDRYYAIVRPLEYPLNMTHKTVCFMLANVWILPALISFTPI 276
Fly 277 FLGWYTTE---EHLREISLHPDQCSFVVNKAYALISSSVSFWIPGIVMLVMYWRIFKEA-IRQRK 337
Fly 338 ALS----RTSS 344 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
Octbeta3R | NP_001034048.2 | 7tm_4 | 146..>346 | CDD:304433 | 80/206 (39%) |
7tm_1 | 156..>344 | CDD:278431 | 74/195 (38%) | ||
hrh2a | NP_001038803.2 | 7tm_1 | 21..284 | CDD:278431 | 76/197 (39%) |
7tm_4 | 21..>112 | CDD:304433 | 42/91 (46%) |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 0 | 0.000 | Not matched by this tool. | |||
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 1 | 1.000 | - | - | H40613 | |
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 1 | 0.910 | - | - | ||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
ZFIN | 0 | 0.000 | Not matched by this tool. | |||
2 | 1.910 |