DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Octbeta3R and drd1b

DIOPT Version :9

Sequence 1:NP_001034048.2 Gene:Octbeta3R / 3885573 FlyBaseID:FBgn0250910 Length:1256 Species:Drosophila melanogaster
Sequence 2:NP_001129448.1 Gene:drd1b / 568126 ZFINID:ZDB-GENE-070524-2 Length:446 Species:Danio rerio


Alignment Length:254 Identity:102/254 - (40%)
Similarity:142/254 - (55%) Gaps:12/254 - (4%)


- Green bases have known domain annotations that are detailed below.


  Fly   120 DIAVDNQAELEESWLDLSLLLLKGFIFSSIILAAVLGNALVIISVQRNRKLR-VITNYFVVSLAM 183
            |:......:...|..|.|..:|.|...|.:||..:|||.||..:|.:.|.|| .:||:||:|||:
Zfish     2 DVNYSTVLDSSVSQRDSSKRVLTGCFLSLLILTTLLGNTLVCAAVTKFRHLRSKVTNFFVISLAI 66

  Fly   184 ADMLVALCAMTFNASVELSGGKWMFGPFMCNVYNSLDVYFSTASILHLCCISVDRYYAIVRPLEY 248
            :|:|||:..|.:.|:.|:. |.|.||.| |:|:.:.|:..||||||:||.||||||:||..|..|
Zfish    67 SDLLVAILVMPWKAATEIV-GFWPFGAF-CDVWVAFDIMCSTASILNLCVISVDRYWAISSPFRY 129

  Fly   249 PLNMTHKTVCFMLANVWILPALISFTPIFLGWYT------TEEHLREISLHPDQCSFVVNKAYAL 307
            ...||.|....|::..|.|..||||.|:.|.|:.      ||.:.....|.||.|...:|:.||:
Zfish   130 ERKMTPKVAFIMISVAWTLSILISFIPVQLNWHKAQTTSYTELNGTYGELPPDNCDSSLNRTYAI 194

  Fly   308 ISSSVSFWIPGIVMLVMYWRIFKEA---IRQRKALSRTSSNILLNSVHMGHTQQPTSLS 363
            .||.:||:||..:|||.|.||::.|   ||:..||.|.:.:.......||:.....|.|
Zfish   195 SSSLISFYIPVAIMLVTYTRIYRIAQKQIRRISALERAAESAKNRHSSMGNNASMESES 253

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Octbeta3RNP_001034048.2 7tm_4 146..>346 CDD:304433 92/209 (44%)
7tm_1 156..>344 CDD:278431 88/197 (45%)
drd1bNP_001129448.1 7tm_1 42..327 CDD:278431 89/214 (42%)
7tm_4 43..>156 CDD:304433 54/114 (47%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR24248
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.