DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Octbeta3R and LOC567498

DIOPT Version :9

Sequence 1:NP_001034048.2 Gene:Octbeta3R / 3885573 FlyBaseID:FBgn0250910 Length:1256 Species:Drosophila melanogaster
Sequence 2:XP_005159907.1 Gene:LOC567498 / 567498 -ID:- Length:398 Species:Danio rerio


Alignment Length:211 Identity:84/211 - (39%)
Similarity:123/211 - (58%) Gaps:25/211 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly   143 GFIFSSIILAAVLGNALVIISVQRNRKLR-VITNYFVVSLAMADMLVALCAMTFNASVELSGGKW 206
            |...|.::|..:|||.:|..:|.|.|.|| .:||.|:|||||:|:|||:..|.:.|:.|:: |.|
Zfish    25 GCALSLLVLWTLLGNFMVCAAVLRFRHLRGKVTNVFIVSLAMSDLLVAVLVMPWKAATEVT-GHW 88

  Fly   207 MFGPFMCNVYNSLDVYFSTASILHLCCISVDRYYAIVRPLEYPLNMTHKTVCFMLANVWILPALI 271
            .||.| |..:.:.|:..||||||:||.||:|||:||..|.:|...|..:....|::..||:...|
Zfish    89 AFGSF-CECWVAFDIMCSTASILNLCVISLDRYWAISDPFQYERKMNRRVALVMVSVTWIVSVAI 152

  Fly   272 SFTPIFLGW------------YTTEEHLREISLHPDQCSFVVNKAYALISSSVSFWIPGIVMLVM 324
            ||.|:.|.|            :||:|          .|...::::||:.||.:||:||..||||.
Zfish   153 SFVPVQLNWHRADLDTVNTSNWTTKE----------MCDSSLSRSYAISSSLISFYIPVAVMLVT 207

  Fly   325 YWRIFKEAIRQRKALS 340
            |.||::.|..|.|::|
Zfish   208 YTRIYRIAQIQIKSIS 223

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Octbeta3RNP_001034048.2 7tm_4 146..>346 CDD:304433 83/208 (40%)
7tm_1 156..>344 CDD:278431 80/198 (40%)
LOC567498XP_005159907.1 7tm_1 38..311 CDD:278431 80/198 (40%)
7tm_4 <104..>156 CDD:304433 24/51 (47%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR24248
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.