DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Octbeta3R and LOC563567

DIOPT Version :9

Sequence 1:NP_001034048.2 Gene:Octbeta3R / 3885573 FlyBaseID:FBgn0250910 Length:1256 Species:Drosophila melanogaster
Sequence 2:XP_005158584.1 Gene:LOC563567 / 563567 -ID:- Length:447 Species:Danio rerio


Alignment Length:279 Identity:98/279 - (35%)
Similarity:150/279 - (53%) Gaps:31/279 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly   117 NGSDIAVD---NQAELEESWLDLSLLLLKGFIFSSIILAAVLGNALVIISVQRNRKLR-VITNYF 177
            ||::...|   ...|.|:.....|:..|.||:...:|::.:|||.||..:|.:.|.|| .:||:|
Zfish     9 NGTNHTQDRAHGAQEREDGDGQNSVRALLGFVLFLLIVSTLLGNTLVCAAVVKFRHLRSKVTNFF 73

  Fly   178 VVSLAMADMLVALCAMTFNASVELSGGKWMFGPFMCNVYNSLDVYFSTASILHLCCISVDRYYAI 242
            |:|||::|:.||:..|.:.| :....|.|:||.| |.::.:.|:..||||||:||.||||||:||
Zfish    74 VISLAVSDLFVAVLVMPWEA-ISAVAGTWLFGRF-CGIWIAFDIMCSTASILNLCIISVDRYWAI 136

  Fly   243 VRPLEYPLNMTHKTVCFMLANVWILPALISFTPIFLGWYTTEEHLREI----SLHPDQCSFVVNK 303
            ..|..|...|||:....|:...|.|..||||.|:.|.|:..::.....    :.:.|.|...:|:
Zfish   137 ASPFRYERKMTHRVAFMMIGVAWTLSILISFIPVQLNWHMADDDEEGAGGNGTDYSDNCKANLNR 201

  Fly   304 AYALISSSVSFWIPGIVMLVMYWRIFKEA---IRQRKALSRTSSNILLNSVHMGHTQQPTSLSYL 365
            .||:.||.:||:||.|:|:..|.|||:.|   ||:..:|.|.          :.|.|     ::.
Zfish   202 TYAISSSLISFYIPVIIMIATYTRIFRIAQTQIRRISSLERA----------VEHAQ-----NHH 251

  Fly   366 HPSDCDLN---ATSAREET 381
            ..:||...   .|:.::||
Zfish   252 QSNDCSNENSLKTTFKKET 270

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Octbeta3RNP_001034048.2 7tm_4 146..>346 CDD:304433 82/207 (40%)
7tm_1 156..>344 CDD:278431 80/195 (41%)
LOC563567XP_005158584.1 7tmA_D1-like_dopamine_R 35..336 CDD:320185 92/253 (36%)
TM helix 1 36..62 CDD:320185 10/25 (40%)
TM helix 2 70..97 CDD:320185 12/27 (44%)
TM helix 3 107..137 CDD:320185 17/29 (59%)
TM helix 4 149..169 CDD:320185 7/19 (37%)
TM helix 5 200..230 CDD:320185 15/29 (52%)
TM helix 6 267..297 CDD:320185 2/4 (50%)
TM helix 7 305..330 CDD:320185
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR24248
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.