DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Octbeta3R and si:dkey-247m21.3

DIOPT Version :9

Sequence 1:NP_001034048.2 Gene:Octbeta3R / 3885573 FlyBaseID:FBgn0250910 Length:1256 Species:Drosophila melanogaster
Sequence 2:XP_017208337.2 Gene:si:dkey-247m21.3 / 559089 ZFINID:ZDB-GENE-091204-249 Length:390 Species:Danio rerio


Alignment Length:279 Identity:107/279 - (38%)
Similarity:163/279 - (58%) Gaps:30/279 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly   116 ANGSDIAVDNQAEL---EESWLDLSLLLLKGFIFSSIILAAVLGNALVIISVQRNRKLR-VITNY 176
            |..||.|.|:..|:   ..|.:.||::|:      :||:...|||.||::::.::|:|| ..||:
Zfish     2 ATASDSAEDSVDEVVSKHTSRITLSIVLV------TIIIMTALGNLLVMVALCKDRQLRKKKTNF 60

  Fly   177 FVVSLAMADMLVALCAMTFNASVELSGGKWMFGPFMCNVYNSLDVYFSTASILHLCCISVDRYYA 241
            |:||||.||:||||..|.. |::||:.|||.:|...|.|..||||..:||||||||||::|||||
Zfish    61 FIVSLAFADLLVALVVMPL-AAIELTTGKWNYGETFCLVRTSLDVLLTTASILHLCCIALDRYYA 124

  Fly   242 I-VRPLEYPLNMTHKTVCFMLANVWILPALISFTPIFLGWYT--TEEHLREISLHPDQ---CSFV 300
            | .:||.|...||...|..||...|::|..|||.||...|.|  .|..:.:..|:..:   |.|:
Zfish   125 ICCQPLVYNNKMTPVRVSLMLVGCWVIPFFISFLPIMQSWNTIGIESFIEQRKLNSSRNSTCVFM 189

  Fly   301 VNKAYALISSSVSFWIPGIVMLVMYWRIFKEAIRQRKALSRTSSNILLNSVHMGHTQQPTSLSYL 365
            ||:.|||:.|:|:|::|.::|::.|.||:..|:...:.         :.|:|...: .|||   .
Zfish   190 VNQPYALVCSAVAFYVPLVLMVLAYQRIYVTAMGHARR---------IGSLHRAGS-APTS---T 241

  Fly   366 HPSDCDLNATSAREETHSA 384
            :|::....::..:.||.:|
Zfish   242 YPNNDQHGSSRIKNETKAA 260

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Octbeta3RNP_001034048.2 7tm_4 146..>346 CDD:304433 88/206 (43%)
7tm_1 156..>344 CDD:278431 85/194 (44%)
si:dkey-247m21.3XP_017208337.2 7tmA_5-HT4 23..325 CDD:320184 100/258 (39%)
TM helix 1 24..50 CDD:320184 10/31 (32%)
TM helix 2 58..84 CDD:320184 15/26 (58%)
TM helix 3 96..126 CDD:320184 21/29 (72%)
TM helix 4 139..162 CDD:320184 10/22 (45%)
TM helix 5 191..220 CDD:320184 12/28 (43%)
TM helix 6 254..284 CDD:320184 3/7 (43%)
TM helix 7 293..318 CDD:320184
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D328277at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 1 0.960 - -
ZFIN 00.000 Not matched by this tool.
43.970

Return to query results.
Submit another query.