DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Octbeta3R and adrb1

DIOPT Version :9

Sequence 1:NP_001034048.2 Gene:Octbeta3R / 3885573 FlyBaseID:FBgn0250910 Length:1256 Species:Drosophila melanogaster
Sequence 2:NP_001122161.1 Gene:adrb1 / 557194 ZFINID:ZDB-GENE-081022-145 Length:390 Species:Danio rerio


Alignment Length:251 Identity:91/251 - (36%)
Similarity:141/251 - (56%) Gaps:14/251 - (5%)


- Green bases have known domain annotations that are detailed below.


  Fly   112 PNITANGSDIAVDNQAELEESWLDLSLLLLKGFIFSSIILAAVLGNALVIISVQRNRKLRVITNY 176
            |::..:...........:.|.|     |:..|.:...|:...|:||.|||:::.||::|:.:||.
Zfish     6 PSVNYSNDSKRATVDLNVSEQW-----LVGMGILMGLIVFVIVVGNILVIVAIARNQRLQTLTNV 65

  Fly   177 FVVSLAMADMLVALCAMTFNASVELSGGKWMFGPFMCNVYNSLDVYFSTASILHLCCISVDRYYA 241
            |:||||.||:::.|..:.|.|::|:.|. ||:|.|.|..:.||||...||||..||.|::|||.|
Zfish    66 FIVSLACADLIMGLLVVPFGAALEVRGA-WMYGSFFCEFWISLDVLCVTASIETLCVIAIDRYIA 129

  Fly   242 IVRPLEYPLNMTHKTVCFMLANVWILPALISFTPIFLGWYTTEEHLREISLH--PDQCSFVVNKA 304
            |:.|..|...:|......::..||.:.||:||.||.:.|....|   |.|.:  |:.|.||.|:|
Zfish   130 IISPFRYQSLLTKARAKVVVCAVWAISALVSFPPILMHWSQDSE---ETSCYENPECCDFVTNRA 191

  Fly   305 YALISSSVSFWIPGIVMLVMYWRIFKEAIRQRKALSRTSSNILLNSVHMGHTQQPT 360
            ||:.||.:||:||.|||:.:|.|:::||.:|...:::.......|.   |...:||
Zfish   192 YAISSSIISFYIPLIVMIFVYARVYREAKQQLNKINKCEGRFYNNH---GTNCKPT 244

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Octbeta3RNP_001034048.2 7tm_4 146..>346 CDD:304433 82/201 (41%)
7tm_1 156..>344 CDD:278431 80/189 (42%)
adrb1NP_001122161.1 7tm_4 40..328 CDD:304433 85/212 (40%)
7tm_1 45..314 CDD:278431 84/207 (41%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D328277at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 1 1.000 - - otm26395
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR24248
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
44.020

Return to query results.
Submit another query.