DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Octbeta3R and Taar3

DIOPT Version :9

Sequence 1:NP_001034048.2 Gene:Octbeta3R / 3885573 FlyBaseID:FBgn0250910 Length:1256 Species:Drosophila melanogaster
Sequence 2:NP_001009532.1 Gene:Taar3 / 494319 RGDID:1359566 Length:342 Species:Rattus norvegicus


Alignment Length:214 Identity:63/214 - (29%)
Similarity:105/214 - (49%) Gaps:16/214 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly   140 LLKGFIFSSIILAAVLGNALVIISVQRNRKLRVITNYFVVSLAMADMLVALCAMTFN--ASVELS 202
            |:...:.:..::..:.||.::|||:...::|...||:.::|:|..|.|:....|.::  .|||  
  Rat    32 LIMYLLMTGAMVITIFGNLVIIISISHFKQLHSPTNFLILSMATTDFLLGFVIMPYSMVRSVE-- 94

  Fly   203 GGKWMFGPFMCNVYNSLDVYFSTASILHLCCISVDRYYAIVRPLEYPLNMTHKTVCFMLANVWIL 267
             ..|.||...|..:.|.|:..|..||.|||.|::||:||:..||.|...||...:..:|...|..
  Rat    95 -SCWYFGDSFCKFHASFDMMLSLTSIFHLCSIAIDRFYAVCAPLHYTTTMTASMIKRLLFFCWAA 158

  Fly   268 PALISFTPIFLGWYTTEEHLREISLHP------DQCSFVVNKAYALISSSVSFWIPGIVMLVMYW 326
            |||.||     |...:|.::..:..:.      :.|:...||.:..|..:..|:.||.:|:.:|.
  Rat   159 PALFSF-----GLVLSEANVSGMQSYEILIACFNFCALTFNKFWGTILFTTCFFTPGSIMVGIYG 218

  Fly   327 RIFKEAIRQRKALSRTSSN 345
            :||..:.|..:||.....|
  Rat   219 KIFIVSRRHARALGNMPEN 237

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Octbeta3RNP_001034048.2 7tm_4 146..>346 CDD:304433 62/208 (30%)
7tm_1 156..>344 CDD:278431 61/195 (31%)
Taar3NP_001009532.1 7tm_4 43..>190 CDD:304433 47/154 (31%)
7tm_1 48..307 CDD:278431 62/198 (31%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
11.000

Return to query results.
Submit another query.