DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Octbeta3R and Taar3

DIOPT Version :9

Sequence 1:NP_001034048.2 Gene:Octbeta3R / 3885573 FlyBaseID:FBgn0250910 Length:1256 Species:Drosophila melanogaster
Sequence 2:NP_001008429.1 Gene:Taar3 / 493809 MGIID:3527427 Length:343 Species:Mus musculus


Alignment Length:211 Identity:65/211 - (30%)
Similarity:108/211 - (51%) Gaps:17/211 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly   144 FIF-SSIILAAVLGNALVIISVQRNRKLRVITNYFVVSLAMADMLVALCAMTFN--ASVELSGGK 205
            ::| :..::..:.||.::|||:...::|...||:.::|:|..|.|:....|.::  .|||   ..
Mouse    35 YLFMTGAMVITIFGNLVIIISISHFKQLHSPTNFLILSMATTDFLLGFVIMPYSMVRSVE---SC 96

  Fly   206 WMFGPFMCNVYNSLDVYFSTASILHLCCISVDRYYAIVRPLEYPLNMTHKTVCFMLANVWILPAL 270
            |.||...|..:.|.|:..|..||.|||.|::||:||:..||.|...||...:..:||..|..|||
Mouse    97 WYFGDSFCKFHASFDMMLSLTSIFHLCSIAIDRFYAVCDPLHYTTTMTVSMIKRLLAFCWAAPAL 161

  Fly   271 ISFTPIFLGWYTTEEHLREISLHP------DQCSFVVNKAYALISSSVSFWIPGIVMLVMYWRIF 329
            .||     |...:|.::..:..:.      :.|:...||.:..|..:..|:.||.:|:.:|.:||
Mouse   162 FSF-----GLVLSEANVSGMQSYEILVACFNFCALTFNKFWGTILFTTCFFTPGSIMVGIYGKIF 221

  Fly   330 KEAIRQRKALSRTSSN 345
            ..:.|..:|||...:|
Mouse   222 IVSRRHARALSDMPAN 237

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Octbeta3RNP_001034048.2 7tm_4 146..>346 CDD:304433 65/209 (31%)
7tm_1 156..>344 CDD:278431 63/195 (32%)
Taar3NP_001008429.1 7tm_4 43..>168 CDD:304433 47/132 (36%)
7tm_1 48..308 CDD:278431 64/198 (32%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
00.000

Return to query results.
Submit another query.