DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Octbeta3R and Taar7f

DIOPT Version :9

Sequence 1:NP_001034048.2 Gene:Octbeta3R / 3885573 FlyBaseID:FBgn0250910 Length:1256 Species:Drosophila melanogaster
Sequence 2:NP_001010839.1 Gene:Taar7f / 435207 MGIID:3527447 Length:358 Species:Mus musculus


Alignment Length:284 Identity:88/284 - (30%)
Similarity:126/284 - (44%) Gaps:59/284 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly    73 DASLTSLSLTATSSDASYS--------SPFSSYLSSDSTFELLSTVGPNITANGSDIAVDNQAEL 129
            |:.|:....:|||::..|.        ||:|.              ||.                
Mouse    13 DSILSRDLFSATSAELCYENLNRSCVRSPYSP--------------GPR---------------- 47

  Fly   130 EESWLDLSLLLLKGFIFSSIILAAVLGNALVIISVQRNRKLRVITNYFVVSLAMADMLVALCAMT 194
                    |:|...|.|.:::  ||.||.||:.|:...|:|....|:.|.|||.||.||.:..|.
Mouse    48 --------LILYAVFGFGAVL--AVCGNLLVMTSILHFRQLHSPANFLVASLACADFLVGVMVMP 102

  Fly   195 FN--ASVELSGGKWMFGPFMCNVYNSLDVYFSTASILHLCCISVDRYYAIVRPLEYPLNMTHKTV 257
            |:  .|||   |.|.||...|.::...||.|...|:.|||.||||||.|:..||.||...|....
Mouse   103 FSMVRSVE---GCWYFGDSYCKLHTCFDVSFCYCSLFHLCFISVDRYIAVSDPLAYPTRFTASVS 164

  Fly   258 CFMLANVWILPALISFTPIFLGWYTTEEHLREI--SLH-PDQCSFVVNKAYALISSSVSFWIPGI 319
            ...:...|:|.....|:.|:.|  .:|..|.::  ||. ...|...||:.:..|:.|| |.||.:
Mouse   165 GKCITFSWLLSISYGFSLIYTG--ASEAGLEDLVSSLTCVGGCQIAVNQTWVFINFSV-FLIPTL 226

  Fly   320 VMLVMYWRIFKEAIRQRKALSRTS 343
            ||:.:|.:||..|.:|.:.:.:.|
Mouse   227 VMITVYSKIFLIAKQQAQNIEKMS 250

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Octbeta3RNP_001034048.2 7tm_4 146..>346 CDD:304433 74/203 (36%)
7tm_1 156..>344 CDD:278431 71/193 (37%)
Taar7fNP_001010839.1 7tm_4 54..>184 CDD:304433 52/134 (39%)
7tm_1 64..326 CDD:278431 71/193 (37%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
00.000

Return to query results.
Submit another query.