DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Octbeta3R and Octbeta1R

DIOPT Version :9

Sequence 1:NP_001034048.2 Gene:Octbeta3R / 3885573 FlyBaseID:FBgn0250910 Length:1256 Species:Drosophila melanogaster
Sequence 2:NP_001262843.1 Gene:Octbeta1R / 42652 FlyBaseID:FBgn0038980 Length:508 Species:Drosophila melanogaster


Alignment Length:347 Identity:176/347 - (50%)
Similarity:218/347 - (62%) Gaps:47/347 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly    31 ATSATNASHLQPATLTGHISTTAAAKTTTTP-TSSLPITSQFVDASLTSLSLTATSSDASYSSPF 94
            |.|||....:    |.|.||:....  |..| .|.:|:             |..::|.|.|....
  Fly     9 AMSATTTRTI----LEGSISSFGGG--TNEPLASKIPV-------------LEESASHARYLKFI 54

  Fly    95 SSYLSSDSTFELLSTVGPNITANGSDIAV-----------DNQAELEESWLD------LSLLLLK 142
            :..|..:.   |.|.||     :||.|||           |.||. |.|..|      |:|:.:|
  Fly    55 ADGLIDEG---LGSAVG-----SGSSIAVSVEDVVAGQAQDIQAS-EGSTDDADGSSHLALVFVK 110

  Fly   143 GFIFSSIILAAVLGNALVIISVQRNRKLRVITNYFVVSLAMADMLVALCAMTFNASVELSGGKWM 207
            .||...|||||:|||.|||:||.|:||||:||||||||||:||||||||||||||||.:| ||||
  Fly   111 CFIIGFIILAAILGNMLVIVSVMRHRKLRIITNYFVVSLAVADMLVALCAMTFNASVMIS-GKWM 174

  Fly   208 FGPFMCNVYNSLDVYFSTASILHLCCISVDRYYAIVRPLEYPLNMTHKTVCFMLANVWILPALIS 272
            ||..||:::||.|||||||||:||||||||||||||:||:|||.||.:.|..||..||:.|||:|
  Fly   175 FGSVMCDMWNSFDVYFSTASIMHLCCISVDRYYAIVQPLDYPLIMTQRRVFIMLLMVWLSPALLS 239

  Fly   273 FTPIFLGWYTTEEHLREISLHPDQCSFVVNKAYALISSSVSFWIPGIVMLVMYWRIFKEAIRQRK 337
            |.||..|||||.|:.:.:..:|..|.|.||||||::|||:||||||||||.||:||::||.||.:
  Fly   240 FLPICSGWYTTTENYKYLKSNPHICEFKVNKAYAIVSSSMSFWIPGIVMLSMYYRIYQEADRQER 304

  Fly   338 ALSRTSSNILLNSVHMGHTQQP 359
            .:.|:....||...|:..:|.|
  Fly   305 LVYRSKVAALLLEKHLQISQIP 326

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Octbeta3RNP_001034048.2 7tm_4 146..>346 CDD:304433 134/199 (67%)
7tm_1 156..>344 CDD:278431 128/187 (68%)
Octbeta1RNP_001262843.1 7tm_4 112..>231 CDD:304433 90/119 (76%)
7tm_1 124..404 CDD:278431 133/204 (65%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45450551
Domainoid 1 1.000 228 1.000 Domainoid score I2479
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D328277at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 1 1.000 - - otm26202
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24248
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
65.950

Return to query results.
Submit another query.