DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Octbeta3R and DopEcR

DIOPT Version :9

Sequence 1:NP_001034048.2 Gene:Octbeta3R / 3885573 FlyBaseID:FBgn0250910 Length:1256 Species:Drosophila melanogaster
Sequence 2:NP_001014559.1 Gene:DopEcR / 38539 FlyBaseID:FBgn0035538 Length:322 Species:Drosophila melanogaster


Alignment Length:234 Identity:67/234 - (28%)
Similarity:99/234 - (42%) Gaps:38/234 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly   140 LLKGFIFSSIILAAVLGNALVIISVQRNRKLRVITNYFVVSLAMADMLVALCAMTFNASVELSGG 204
            |.|..:.|.:.:|.||.|.|:|.:....:....:.||:::|||:||:|..|..:.|:....|: |
  Fly    16 LTKAVLISILGVAIVLSNLLIIATYANFKGPTEVINYYLLSLAIADLLCGLLVVPFSVYPALT-G 79

  Fly   205 KWMFGPFMCNVYNSLDVYFSTASILHLCCISVDRYYAIVRPLEYPLNMTHKTVC-FMLANVWILP 268
            :||:|..:|.....|:|.....|:.....||||||.|:.:||.|....| ||.| ..:...||..
  Fly    80 EWMYGDIVCRFTGYLEVTLWAVSVYTFMWISVDRYLAVRKPLRYETVQT-KTRCQCWMVFTWISA 143

  Fly   269 ALISFTPI---------------FLGWYTTEEH---LREISLHPDQCSFVVNKAYALISSSVSFW 315
            ||:...||               .|.|.....:   |..:.|.|...|.|.|..|          
  Fly   144 ALLCCPPILGYSMPIENNMTHICMLDWGNMAAYSATLAILVLGPSLISIVHNYGY---------- 198

  Fly   316 IPGIVMLVMYWRIFK-EAIRQRKALSRTSSNILLNSVHM 353
                 :.||..:|.. |.|..::..:..:.| |.|..||
  Fly   199 -----IFVMMRKIRSGEPIHDKEYATALAEN-LSNPSHM 231

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Octbeta3RNP_001034048.2 7tm_4 146..>346 CDD:304433 60/219 (27%)
7tm_1 156..>344 CDD:278431 56/207 (27%)
DopEcRNP_001014559.1 7tm_classA_rhodopsin-like 18..289 CDD:410626 66/232 (28%)
TM helix 1 18..42 CDD:410626 8/23 (35%)
TM helix 2 51..73 CDD:410626 10/21 (48%)
TM helix 3 89..111 CDD:410626 4/21 (19%)
TM helix 4 134..150 CDD:410626 4/15 (27%)
TM helix 5 174..197 CDD:410626 6/22 (27%)
TM helix 6 230..252 CDD:410626 2/2 (100%)
TM helix 7 264..289 CDD:410626
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45460663
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24248
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.030

Return to query results.
Submit another query.