DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Octbeta3R and HTR4

DIOPT Version :9

Sequence 1:NP_001034048.2 Gene:Octbeta3R / 3885573 FlyBaseID:FBgn0250910 Length:1256 Species:Drosophila melanogaster
Sequence 2:NP_001035263.1 Gene:HTR4 / 3360 HGNCID:5299 Length:428 Species:Homo sapiens


Alignment Length:274 Identity:106/274 - (38%)
Similarity:152/274 - (55%) Gaps:31/274 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly   123 VDNQAELEESWLDLSLLLLKGFIFSSIILAAVLGNALVIISVQRNRKLRVI-TNYFVVSLAMADM 186
            :|.....||.:..:..::|..|: |::||.|:|||.||:::|..:|:||.| ||||:||||.||:
Human     4 LDANVSSEEGFGSVEKVVLLTFL-STVILMAILGNLLVMVAVCWDRQLRKIKTNYFIVSLAFADL 67

  Fly   187 LVALCAMTFNASVELSGGKWMFGPFMCNVYNSLDVYFSTASILHLCCISVDRYYAI-VRPLEYPL 250
            ||::..|.|.| :||....|::|...|.|..||||..:||||.||||||:|||||| .:||.|..
Human    68 LVSVLVMPFGA-IELVQDIWIYGEVFCLVRTSLDVLLTTASIFHLCCISLDRYYAICCQPLVYRN 131

  Fly   251 NMTHKTVCFMLANVWILPALISFTPIFLGWYT------TEEHLREISLHPDQCSFVVNKAYALIS 309
            .||...:..||...|::|..|||.||..||..      .|:.....:.:...|.|:|||.||:..
Human   132 KMTPLRIALMLGGCWVIPTFISFLPIMQGWNNIGIIDLIEKRKFNQNSNSTYCVFMVNKPYAITC 196

  Fly   310 SSVSFWIPGIVMLVMYWRIF---KEAIRQRKALSRTSSNILLNSVHMGHTQQPTSLSYLHPSDCD 371
            |.|:|:||.::|::.|:||:   ||...|.:.|.|..::                 |...|...|
Human   197 SVVAFYIPFLLMVLAYYRIYVTAKEHAHQIQMLQRAGAS-----------------SESRPQSAD 244

  Fly   372 LNAT-SAREETHSA 384
            .::| ..|.||.:|
Human   245 QHSTHRMRTETKAA 258

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Octbeta3RNP_001034048.2 7tm_4 146..>346 CDD:304433 93/210 (44%)
7tm_1 156..>344 CDD:278431 88/198 (44%)
HTR4NP_001035263.1 7tm_1 36..312 CDD:278431 96/241 (40%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D328277at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 1 1.000 - - otm40768
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
43.920

Return to query results.
Submit another query.