DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Octbeta3R and HTR1B

DIOPT Version :10

Sequence 1:NP_001034048.2 Gene:Octbeta3R / 3885573 FlyBaseID:FBgn0250910 Length:1256 Species:Drosophila melanogaster
Sequence 2:NP_000854.1 Gene:HTR1B / 3351 HGNCID:5287 Length:390 Species:Homo sapiens


Alignment Length:259 Identity:82/259 - (31%)
Similarity:129/259 - (49%) Gaps:23/259 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly   112 PNITANGSDIAVDNQAELEESWLDLSLLLLKGFIFSSIILAAVLGNALVIISVQRNRKLRVITNY 176
            |:...:..|....:...|  .|..|.::||     :.|.||..|.||.||.:|.|.|||....||
Human    29 PSQNCSAKDYIYQDSISL--PWKVLLVMLL-----ALITLATTLSNAFVIATVYRTRKLHTPANY 86

  Fly   177 FVVSLAMADMLVALCAMTFNASVELSGGKWMFGPFMCNVYNSLDVYFSTASILHLCCISVDRYYA 241
            .:.|||:.|:||::..|..:....:: |:|..|..:|:.:.|.|:...||||||||.|::|||:|
Human    87 LIASLAVTDLLVSILVMPISTMYTVT-GRWTLGQVVCDFWLSSDITCCTASILHLCVIALDRYWA 150

  Fly   242 IVRPLEYPLNMTHKTVCFMLANVWILPALISFTPIFLGWYTTEEHLREISLHPDQCSFVVNKAYA 306
            |...:||....|.|....|:|.||:....||..|.|......||.:.|..::.|..      .|.
Human   151 ITDAVEYSAKRTPKRAAVMIALVWVFSISISLPPFFWRQAKAEEEVSECVVNTDHI------LYT 209

  Fly   307 LISSSVSFWIPGIVMLVMYWRIFKEA----IRQ---RKALSRTSSNILLNSVHMGHTQQPTSLS 363
            :.|:..:|:.|.::::.:|.||:.||    ::|   |.....|.:.::.:|  .|.|...||::
Human   210 VYSTVGAFYFPTLLLIALYGRIYVEARSRILKQTPNRTGKRLTRAQLITDS--PGSTSSVTSIN 271

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Octbeta3RNP_001034048.2 7tmA_DmOct-betaAR-like 142..>338 CDD:320194 69/202 (34%)
TM helix 1 142..167 CDD:320194 9/24 (38%)
TM helix 2 174..200 CDD:320194 9/25 (36%)
TM helix 3 213..243 CDD:320194 16/29 (55%)
TM helix 4 255..278 CDD:320194 8/22 (36%)
TM helix 5 302..331 CDD:320194 7/28 (25%)
7tm_GPCRs <1161..1234 CDD:475119
TM helix 6 1167..1189 CDD:410628
TM helix 7 1202..1227 CDD:410628
HTR1BNP_000854.1 7tmA_5-HT1B_1D 46..380 CDD:320455 80/242 (33%)
TM helix 1 51..77 CDD:320455 12/30 (40%)
TM helix 2 84..110 CDD:320455 9/25 (36%)
TM helix 3 122..152 CDD:320455 16/29 (55%)
DRY motif, important for ligand-induced conformation changes and signaling. /evidence=ECO:0000250|UniProtKB:P41595 146..148 1/1 (100%)
TM helix 4 164..187 CDD:320455 8/22 (36%)
TM helix 5 205..234 CDD:320455 7/34 (21%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 259..281 5/15 (33%)
TM helix 6 307..337 CDD:320455
TM helix 7 348..373 CDD:320455
NPxxY motif, important for ligand-induced conformation changes and signaling. /evidence=ECO:0000250|UniProtKB:P41595 365..369
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.