DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Octbeta3R and HRH2

DIOPT Version :9

Sequence 1:NP_001034048.2 Gene:Octbeta3R / 3885573 FlyBaseID:FBgn0250910 Length:1256 Species:Drosophila melanogaster
Sequence 2:NP_001354640.1 Gene:HRH2 / 3274 HGNCID:5183 Length:422 Species:Homo sapiens


Alignment Length:458 Identity:124/458 - (27%)
Similarity:196/458 - (42%) Gaps:96/458 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly   110 VGPNITANGSDIAVDNQAELEESWLDLSLLLLKGFIFSSIILAAVLGNALVIISVQRNRKLRVIT 174
            :.||.||  |...:|:.|      ..:::.:    :.:.:||..|.||.:|.::|..||:||.:|
Human     1 MAPNGTA--SSFCLDSTA------CKITITV----VLAVLILITVAGNVVVCLAVGLNRRLRNLT 53

  Fly   175 NYFVVSLAMADMLVALCAMTFNASVELSGGKWMFGPFMCNVYNSLDVYFSTASILHLCCISVDRY 239
            |.|:||||:.|:|:.|..:.|:|..:|| .||.||...||:|.||||...|||||:|..||:|||
Human    54 NCFIVSLAITDLLLGLLVLPFSAIYQLS-CKWSFGKVFCNIYTSLDVMLCTASILNLFMISLDRY 117

  Fly   240 YAIVRPLEYPLNMTHKTVCFMLANVWILPALISFTPIFLGWYTTEE-----HLREISLHPDQCSF 299
            .|::.||.||:.:|...|...|..:|::...:||..|.|||.:..|     |.      ..:|..
Human   118 CAVMDPLRYPVLVTPVRVAISLVLIWVISITLSFLSIHLGWNSRNETSKGNHT------TSKCKV 176

  Fly   300 VVNKAYALISSSVSFWIPGIVMLVMYWRIFKEAIRQRKALSRTSS-----------NILLNSVHM 353
            .||:.|.|:...|:|::|.::|.:.|:||||.|..|.|.::..||           .:.|.:| |
Human   177 QVNEVYGLVDGLVTFYLPLLIMCITYYRIFKVARDQAKRINHISSWKAATIREHKATVTLAAV-M 240

  Fly   354 GH---TQQPTSLSYLHPSDCDLNATSAREETHSAL--------SNLEDMLQPATDEDDDRDECDE 407
            |.   ...|...::::..   |....|..|...|:        |.|..:|..|.:.|        
Human   241 GAFIICWFPYFTAFVYRG---LRGDDAINEVLEAIVLWLGYANSALNPILYAALNRD-------- 294

  Fly   408 LRVPSPPPRRLSRSSIDLRDLEQERYEKVTHTDSAPSMMALQQQQPSHNQLQPPAPVFNPQIWTE 472
                    .|.....:....|......|.:...:|..:...|.::|...:.:|    ...|:|:.
Human   295 --------FRTGYQQLFCCRLANRNSHKTSLRSNASQLSRTQSREPRQQEEKP----LKLQVWSG 347

  Fly   473 GKM-IPSKELDKE-------------------------HSHPNGPQQQLSLTSGSGNSEPEPEST 511
            .:: .|....|::                         ..|..||.::||....|...:..|...
Human   348 TEVTAPQGATDRKPALSCTTCSSNLLSCCKSLWGLRFLQRHMGGPSEELSGEPLSEEPQKRPPQK 412

  Fly   512 AYR 514
            |.|
Human   413 AVR 415

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Octbeta3RNP_001034048.2 7tm_4 146..>346 CDD:304433 83/215 (39%)
7tm_1 156..>344 CDD:278431 78/192 (41%)
HRH2NP_001354640.1 7tmA_Histamine_H2R 19..299 CDD:320179 98/310 (32%)
TM helix 1 21..45 CDD:320179 7/27 (26%)
TM helix 2 54..76 CDD:320179 10/21 (48%)
TM helix 3 92..114 CDD:320179 13/21 (62%)
TM helix 4 137..153 CDD:320179 4/15 (27%)
TM helix 5 180..203 CDD:320179 6/22 (27%)
TM helix 6 233..255 CDD:320179 5/22 (23%)
TM helix 7 267..292 CDD:320179 6/24 (25%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 316..340 4/27 (15%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 1 1.000 - - H40613
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
User_Submission 00.000 Not matched by this tool.
32.870

Return to query results.
Submit another query.