DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Octbeta3R and Taar8b

DIOPT Version :9

Sequence 1:NP_001034048.2 Gene:Octbeta3R / 3885573 FlyBaseID:FBgn0250910 Length:1256 Species:Drosophila melanogaster
Sequence 2:XP_006227781.1 Gene:Taar8b / 319106 RGDID:631386 Length:359 Species:Rattus norvegicus


Alignment Length:224 Identity:76/224 - (33%)
Similarity:118/224 - (52%) Gaps:17/224 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly   136 LSLLLLKGFIFSSIILAAVLGNALVIISVQRNRKLRVITNYFVVSLAMADMLVALCAMTFN--AS 198
            |.:||...|.|.:::  ||.||.||:|||...::|....|:.:.|||.||.||.:..|.|:  .|
  Rat    45 LRVLLYMVFGFGAVL--AVCGNLLVVISVLHFKQLHSPANFLIASLASADFLVGISVMPFSMVRS 107

  Fly   199 VELSGGKWMFGPFMCNVYNSLDVYFSTASILHLCCISVDRYYAIVRPLEYPLNMTHKT--VCFML 261
            :|   ..|.||...|::::..|..|..:|:.|||.||||||.|:..||.||...|...  :|..:
  Rat   108 IE---SCWYFGDTFCSLHSCCDAAFCYSSLFHLCFISVDRYIAVTEPLVYPTKFTMSVSGICISI 169

  Fly   262 ANVWILPALISFTPIFLGWYTTE-EHLREISLHPDQCSFVVNKAYALISSSVSFWIPGIVMLVMY 325
            :  ||||.:.|....:.|...|. |:|.........|...:|:.:.|| |.:.|:||.:||:::|
  Rat   170 S--WILPLVYSSAVFYTGISATGIENLVSALNCVGGCQVAINQDWVLI-SFLLFFIPTLVMIILY 231

  Fly   326 WRIF----KEAIRQRKALSRTSSNILLNS 350
            .:||    ::|::...::|.:.....|.|
  Rat   232 SKIFLVAKQQAVKIETSISGSKGESSLES 260

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Octbeta3RNP_001034048.2 7tm_4 146..>346 CDD:304433 70/208 (34%)
7tm_1 156..>344 CDD:278431 67/196 (34%)
Taar8bXP_006227781.1 7tm_4 57..342 CDD:304433 71/212 (33%)
7tm_1 63..327 CDD:278431 69/204 (34%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
11.000

Return to query results.
Submit another query.