DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Octbeta3R and mAChR-C

DIOPT Version :9

Sequence 1:NP_001034048.2 Gene:Octbeta3R / 3885573 FlyBaseID:FBgn0250910 Length:1256 Species:Drosophila melanogaster
Sequence 2:NP_572358.1 Gene:mAChR-C / 31626 FlyBaseID:FBgn0029909 Length:371 Species:Drosophila melanogaster


Alignment Length:290 Identity:83/290 - (28%)
Similarity:132/290 - (45%) Gaps:43/290 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly    89 SYSSPFSSYLSSDSTFELLSTVGPNITANGSDIAVDNQAELEES----WLDLSLLLLKGFIFSSI 149
            |.|||...|.||.....::..:..:..|..:...:..||....:    |     |.:..|:| .:
  Fly     5 SSSSPAWDYRSSPEALGVVPFLWQHQNATETPTEITLQATSFGAGHLLW-----LAINAFLF-VL 63

  Fly   150 ILAAVLGNALVIISVQRNRKLR-VITNYFVVSLAMADMLVALCA---MTFNASVELSGGKWMFGP 210
            ||.   ||.|.|::|:..|.|| ||:|.|::|||::|..|.|..   :.|....::..   |.||
  Fly    64 ILG---GNILTIVAVRTCRHLRSVISNLFILSLAVSDFCVGLALPYHLVFYMGSDIGA---MRGP 122

  Fly   211 FMCNVYNSLDVYFSTASILHLCCISVDRYYAIVRPLEYPLNMTHKTVCFMLANVWILPALISFTP 275
            .:...:  |.:.....|:|.|..|:||||.|:|..|.|...||.:....::...|.|.||::..|
  Fly   123 CLLRFF--LLICACCVSMLTLISIAVDRYIAVVYALHYRRYMTRRVAYSIIIFNWCLGALVALLP 185

  Fly   276 IFLG-WYTTEEHLREISLHPDQCSFVVNKAYALISSSVSFWIPGIVMLVMYWRIFKEAIRQRKAL 339
            :|.. |...:....:..|.|...:.|:...:.:|      |   |.|.::||||.:||.:|  ||
  Fly   186 VFWNRWPDAQACEFDEVLAPGYIAGVITPGFVII------W---ICMFLVYWRIMREASKQ--AL 239

  Fly   340 SRTSSNILLNSVHMGHTQQPTSLS--YLHP 367
             |...:::.|      |.:.|::.  .|||
  Fly   240 -RLRQSVVYN------TDEATTMRNLLLHP 262

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Octbeta3RNP_001034048.2 7tm_4 146..>346 CDD:304433 64/204 (31%)
7tm_1 156..>344 CDD:278431 61/192 (32%)
mAChR-CNP_572358.1 7tm_4 61..332 CDD:304433 70/229 (31%)
7tm_1 67..321 CDD:278431 67/219 (31%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45460641
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.840

Return to query results.
Submit another query.