DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Octbeta3R and Taar7b

DIOPT Version :9

Sequence 1:NP_001034048.2 Gene:Octbeta3R / 3885573 FlyBaseID:FBgn0250910 Length:1256 Species:Drosophila melanogaster
Sequence 2:NP_783176.2 Gene:Taar7b / 294126 RGDID:631392 Length:358 Species:Rattus norvegicus


Alignment Length:237 Identity:77/237 - (32%)
Similarity:110/237 - (46%) Gaps:34/237 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly   138 LLLLKGFIFSSIILAAVLGNALVIISVQRNRKLRVITNYFVVSLAMADMLVALCAMTFN--ASVE 200
            |:|...|.|.:::  ||.||.||:.|:...|:|....|:.|.|||.||.||.|..|.|:  .|||
  Rat    48 LILYAVFGFGAVL--AVCGNLLVMTSILHFRQLHSPANFLVASLACADFLVGLTVMPFSMVRSVE 110

  Fly   201 LSGGKWMFGPFMCNVYNSLDVYFSTASILHLCCISVDRYYAIVRPLEYPLNMTHKTVCFMLANVW 265
               |.|.||...|..::|.|..|..:||.|||.||.|||.|:..||.||...|.......:...|
  Rat   111 ---GCWYFGDIYCKFHSSFDGSFCYSSIFHLCFISADRYIAVSDPLIYPTRFTASVSGKCITFSW 172

  Fly   266 ILPALISFTPIFLGWYTTEEHLREISLHP--------DQCSFVVNKAYALISSSVSFWIPGIVML 322
            :|..:.||:..:.|       :.|..|..        ..|...||:::..| :.:.|.:|.:||:
  Rat   173 LLSIIYSFSLFYTG-------VNEAGLEDLVSALTCVGGCQIAVNQSWVFI-NFLLFLVPALVMM 229

  Fly   323 VMYWRIFKEAIRQRKALSRTSSNILLNSVHMGHTQQPTSLSY 364
            .:|.:||..|.:|.:.:.:           ||......|.||
  Rat   230 TVYSKIFLIAKQQAQNIEK-----------MGKQTARASESY 260

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Octbeta3RNP_001034048.2 7tm_4 146..>346 CDD:304433 69/209 (33%)
7tm_1 156..>344 CDD:278431 66/197 (34%)
Taar7bNP_783176.2 7tm_GPCRs 49..337 CDD:421689 76/236 (32%)
TM helix 1 49..75 CDD:410628 10/27 (37%)
TM helix 2 82..108 CDD:410628 12/25 (48%)
TM helix 3 120..150 CDD:410628 15/29 (52%)
TM helix 4 162..185 CDD:410628 4/22 (18%)
TM helix 5 209..238 CDD:410628 10/29 (34%)
TM helix 6 266..296 CDD:410628
TM helix 7 305..330 CDD:410628
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
00.000

Return to query results.
Submit another query.