DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Octbeta3R and Taar6

DIOPT Version :9

Sequence 1:NP_001034048.2 Gene:Octbeta3R / 3885573 FlyBaseID:FBgn0250910 Length:1256 Species:Drosophila melanogaster
Sequence 2:NP_783174.1 Gene:Taar6 / 294124 RGDID:631384 Length:345 Species:Rattus norvegicus


Alignment Length:257 Identity:85/257 - (33%)
Similarity:123/257 - (47%) Gaps:42/257 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly   138 LLLLKGFIFSSIILAAVLGNALVIISVQRNRKLRVITNYFVVSLAMADMLVALCAMTFN--ASVE 200
            :||...|.|.:::  ||.||.||:||:...::|...||:.:.|||.||..|.:..|.|:  .|:|
  Rat    33 VLLYAVFGFGAVL--AVFGNLLVMISILHFKQLHSPTNFLIASLACADFWVGVSVMPFSMVRSIE 95

  Fly   201 LSGGKWMFGPFMCNVYNSLDVYFSTASILHLCCISVDRYYAIVRPLEYPLNMTHKT--VCFMLAN 263
               ..|.||...|..:...||.|..:|:.||..||:|||.|:..||.||...|...  :|..:: 
  Rat    96 ---SCWYFGRSFCTFHTCCDVAFCYSSLFHLSFISIDRYIAVTDPLVYPTKFTVSVSGICISIS- 156

  Fly   264 VWILPALISFTPIFLGWYTTEEHLREISLHPDQ------CSFVVNKAYALISSSVSFWIPGIVML 322
             ||||...|....:.|.|.  :.|.|:|   |.      |..|||:.:.|| ..:||.||.:||:
  Rat   157 -WILPLAYSGAVFYTGVYA--DGLEEVS---DAVNCVGGCQVVVNQNWVLI-DFLSFLIPTLVMI 214

  Fly   323 VMYWRIFKEAIRQRKALSRTSSNILLNSVHMGHTQQPTSLSYLHPSDCDLNATSAREETHSA 384
            ::|..||..|.:|.|.:..           :|:..:.:|.||        .|..||.|..:|
  Rat   215 ILYGNIFLVARQQAKKIET-----------VGNKAESSSESY--------KARVARRERKAA 257

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Octbeta3RNP_001034048.2 7tm_4 146..>346 CDD:304433 73/209 (35%)
7tm_1 156..>344 CDD:278431 70/197 (36%)
Taar6NP_783174.1 7tmA_TAAR6_8_9 33..322 CDD:320439 85/257 (33%)
TM helix 1 35..59 CDD:320439 11/25 (44%)
TM helix 2 68..90 CDD:320439 9/21 (43%)
TM helix 3 106..128 CDD:320439 7/21 (33%)
TM helix 4 151..167 CDD:320439 6/17 (35%)
TM helix 5 195..218 CDD:320439 9/23 (39%)
TM helix 6 257..279 CDD:320439 1/1 (100%)
TM helix 7 290..315 CDD:320439
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
00.000

Return to query results.
Submit another query.