DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Octbeta3R and Taar2

DIOPT Version :9

Sequence 1:NP_001034048.2 Gene:Octbeta3R / 3885573 FlyBaseID:FBgn0250910 Length:1256 Species:Drosophila melanogaster
Sequence 2:NP_001008512.1 Gene:Taar2 / 294121 RGDID:1311240 Length:339 Species:Rattus norvegicus


Alignment Length:254 Identity:72/254 - (28%)
Similarity:116/254 - (45%) Gaps:21/254 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly    95 SSYLSSDSTFELLSTVGPNITANGSDIAVDNQAELEESWLDLSLLLLKGFIFSSIILAAVLGNAL 159
            :|:.:...||: .|..|     |||  ..:|:..|.......|  |:.|.||.:|     .||.:
  Rat     2 TSFEAQQETFD-CSEYG-----NGS--CPENERSLGVRAAMYS--LMAGAIFITI-----FGNLV 51

  Fly   160 VIISVQRNRKLRVITNYFVVSLAMADMLVALCAMTFN--ASVELSGGKWMFGPFMCNVYNSLDVY 222
            :|||:...::|...||..::|:|:.|.|:....|.::  .|||   ..|.||...|.::.|.|:.
  Rat    52 MIISISYFKQLHTPTNLLILSMAVTDFLLGFTIMPYSMVRSVE---NCWYFGLTFCKIHYSFDLM 113

  Fly   223 FSTASILHLCCISVDRYYAIVRPLEYPLNMTHKTVCFMLANVWILPALISFTPIFLGWYTTEEHL 287
            .|..||.|||.:::||:|||..||.|...||...|..:|...|.:|...:|..:|...|......
  Rat   114 LSITSIFHLCSVAIDRFYAICHPLHYCTKMTIPVVKRLLLVCWSVPGAFAFGVVFSEAYADGIEG 178

  Fly   288 REISLH-PDQCSFVVNKAYALISSSVSFWIPGIVMLVMYWRIFKEAIRQRKALSRTSSN 345
            .:|.:. ...|..:.||.:........|:.|..:|:.:|.:||..:.:..:.:.....|
  Rat   179 YDILVACSSSCPVMFNKLWGTTLFVAGFFTPSSMMVGIYGKIFAVSKKHARVIDNLPEN 237

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Octbeta3RNP_001034048.2 7tm_4 146..>346 CDD:304433 58/203 (29%)
7tm_1 156..>344 CDD:278431 55/190 (29%)
Taar2NP_001008512.1 7tm_4 42..315 CDD:304433 59/204 (29%)
7tm_1 48..303 CDD:278431 56/193 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
00.000

Return to query results.
Submit another query.