DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Octbeta3R and Adrb3

DIOPT Version :9

Sequence 1:NP_001034048.2 Gene:Octbeta3R / 3885573 FlyBaseID:FBgn0250910 Length:1256 Species:Drosophila melanogaster
Sequence 2:XP_008769537.1 Gene:Adrb3 / 25645 RGDID:2061 Length:421 Species:Rattus norvegicus


Alignment Length:195 Identity:84/195 - (43%)
Similarity:116/195 - (59%) Gaps:3/195 - (1%)


- Green bases have known domain annotations that are detailed below.


  Fly   149 IILAAVLGNALVIISVQRNRKLRVITNYFVVSLAMADMLVALCAMTFNASVELSGGKWMFGPFMC 213
            :.||.|.||.|||.::.|..:|:.|||.||.|||.||::|.|..|...|::.|: |.|..|...|
  Rat    65 LALATVGGNLLVITAIARTPRLQTITNVFVTSLATADLVVGLLVMPPGATLALT-GHWPLGATGC 128

  Fly   214 NVYNSLDVYFSTASILHLCCISVDRYYAIVRPLEYPLNMTHKTVCFMLANVWILPALISFTPIFL 278
            .::.|:||...||||..||.::||||.|:..||.|...:|.:.....:..|||:.|.:||.||..
  Rat   129 ELWTSVDVLCVTASIETLCALAVDRYLAVTNPLRYGTLVTKRRARAAVVLVWIVSATVSFAPIMS 193

  Fly   279 GWYT--TEEHLREISLHPDQCSFVVNKAYALISSSVSFWIPGIVMLVMYWRIFKEAIRQRKALSR 341
            .|:.  .:...:|...:|..|||..|..|||:||||||::|.:|||.:|.|:|..|.|||:.|.|
  Rat   194 QWWRVGADAEAQECHSNPRCCSFASNMPYALLSSSVSFYLPLLVMLFVYARVFVVAKRQRRLLRR 258

  Fly   342  341
              Rat   259  258

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Octbeta3RNP_001034048.2 7tm_4 146..>346 CDD:304433 84/195 (43%)
7tm_1 156..>344 CDD:278431 81/188 (43%)
Adrb3XP_008769537.1 7tm_1 72..364 CDD:278431 81/188 (43%)
7tm_4 72..>166 CDD:304433 43/94 (46%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 230 1.000 Domainoid score I2359
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 1 1.000 - - otm44908
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR24248
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
55.010

Return to query results.
Submit another query.