DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Octbeta3R and Htr4

DIOPT Version :9

Sequence 1:NP_001034048.2 Gene:Octbeta3R / 3885573 FlyBaseID:FBgn0250910 Length:1256 Species:Drosophila melanogaster
Sequence 2:NP_036985.2 Gene:Htr4 / 25324 RGDID:2850 Length:388 Species:Rattus norvegicus


Alignment Length:273 Identity:108/273 - (39%)
Similarity:150/273 - (54%) Gaps:40/273 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly   134 LDLSLLLLKGF----------IFSSIILAAVLGNALVIISVQRNRKLRVI-TNYFVVSLAMADML 187
            ||.::...:||          .|:.:||.|:|||.||:::|.|:|:||.| ||||:||||.||:|
  Rat     4 LDANVSSNEGFGSVEKVVLLTFFAMVILMAILGNLLVMVAVCRDRQLRKIKTNYFIVSLAFADLL 68

  Fly   188 VALCAMTFNASVELSGGKWMFGPFMCNVYNSLDVYFSTASILHLCCISVDRYYAI-VRPLEYPLN 251
            |::..|.|.| :||....|.:|...|.|..||||..:||||.||||||:|||||| .:||.|...
  Rat    69 VSVLVMPFGA-IELVQDIWFYGEMFCLVRTSLDVLLTTASIFHLCCISLDRYYAICCQPLVYRNK 132

  Fly   252 MTHKTVCFMLANVWILPALISFTPIFLGWY------TTEEHLREISLHPDQCSFVVNKAYALISS 310
            ||...:..||...|::|..|||.||..||.      ..|:.....:.:...|.|:|||.||:..|
  Rat   133 MTPLRIALMLGGCWVIPMFISFLPIMQGWNNIGIVDVIEKRKFNHNSNSTFCVFMVNKPYAITCS 197

  Fly   311 SVSFWIPGIVMLVMYWRIF---KEAIRQRKALSRTSSNILLNSVHMGHTQQPTSLSYLHPSDCDL 372
            .|:|:||.::|::.|:||:   ||..:|.:.|.|..:               ||.|  .|...|.
  Rat   198 VVAFYIPFLLMVLAYYRIYVTAKEHAQQIQMLQRAGA---------------TSES--RPQTADQ 245

  Fly   373 NAT-SAREETHSA 384
            ::| ..|.||.:|
  Rat   246 HSTHRMRTETKAA 258

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Octbeta3RNP_001034048.2 7tm_4 146..>346 CDD:304433 94/210 (45%)
7tm_1 156..>344 CDD:278431 89/198 (45%)
Htr4NP_036985.2 7tmA_5-HT4 20..323 CDD:320184 104/257 (40%)
TM helix 1 22..46 CDD:320184 10/23 (43%)
TM helix 2 56..78 CDD:320184 13/21 (62%)
TM helix 3 94..116 CDD:320184 14/21 (67%)
TM helix 4 140..156 CDD:320184 7/15 (47%)
TM helix 5 190..213 CDD:320184 9/22 (41%)
TM helix 6 258..280 CDD:320184 1/1 (100%)
TM helix 7 291..316 CDD:320184
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D328277at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 1 1.000 - - otm44908
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
43.970

Return to query results.
Submit another query.