DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Octbeta3R and Adrb1

DIOPT Version :9

Sequence 1:NP_001034048.2 Gene:Octbeta3R / 3885573 FlyBaseID:FBgn0250910 Length:1256 Species:Drosophila melanogaster
Sequence 2:NP_036833.1 Gene:Adrb1 / 24925 RGDID:2059 Length:466 Species:Rattus norvegicus


Alignment Length:259 Identity:89/259 - (34%)
Similarity:139/259 - (53%) Gaps:9/259 - (3%)


- Green bases have known domain annotations that are detailed below.


  Fly   122 AVDNQAELEESW-LDLSLLLLKGFIFSSIILAAVLGNALVIISVQRNRKLRVITNYFVVSLAMAD 185
            |.:..|.|.:.| ..:.|||      :.|:|..|:||.|||:::.:..:|:.:||.|::|||.||
  Rat    46 ASEGSAPLSQQWTAGMGLLL------ALIVLLIVVGNVLVIVAIAKTPRLQTLTNLFIMSLASAD 104

  Fly   186 MLVALCAMTFNASVELSGGKWMFGPFMCNVYNSLDVYFSTASILHLCCISVDRYYAIVRPLEYPL 250
            :::.|..:.|.|:: :..|:|.:|.|.|.::.|:||...||||..||.|::|||.||..|..|..
  Rat   105 LVMGLLVVPFGATI-VVWGRWEYGSFFCELWTSVDVLCVTASIETLCVIALDRYLAITLPFRYQS 168

  Fly   251 NMTHKTVCFMLANVWILPALISFTPIFLGWYTTE-EHLREISLHPDQCSFVVNKAYALISSSVSF 314
            .:|......::..||.:.||:||.||.:.|:..| :..|.....|..|.||.|:|||:.||.|||
  Rat   169 LLTRARARALVCTVWAISALVSFLPILMHWWRAESDEARRCYNDPKCCDFVTNRAYAIASSVVSF 233

  Fly   315 WIPGIVMLVMYWRIFKEAIRQRKALSRTSSNILLNSVHMGHTQQPTSLSYLHPSDCDLNATSAR 378
            ::|..:|..:|.|:|:||.:|.|.:.......|.............|.....|:|...|..|::
  Rat   234 YVPLCIMAFVYLRVFREAQKQVKKIDSCERRFLTGPPRPPSPAPSPSPGPPRPADSLANGRSSK 297

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Octbeta3RNP_001034048.2 7tm_4 146..>346 CDD:304433 76/200 (38%)
7tm_1 156..>344 CDD:278431 73/188 (39%)
Adrb1NP_036833.1 7tm_1 75..366 CDD:278431 79/224 (35%)
7tm_4 76..>267 CDD:304433 72/191 (38%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 264..302 6/34 (18%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 398..466
PDZ-Binding. /evidence=ECO:0000250 463..466
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 230 1.000 Domainoid score I2359
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D328277at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 1 1.000 - - otm44908
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR24248
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
55.020

Return to query results.
Submit another query.