DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Octbeta3R and Drd1

DIOPT Version :9

Sequence 1:NP_001034048.2 Gene:Octbeta3R / 3885573 FlyBaseID:FBgn0250910 Length:1256 Species:Drosophila melanogaster
Sequence 2:NP_036678.3 Gene:Drd1 / 24316 RGDID:2518 Length:446 Species:Rattus norvegicus


Alignment Length:272 Identity:100/272 - (36%)
Similarity:152/272 - (55%) Gaps:36/272 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly   125 NQAELEESWL----DLSLLLLKGFIFSSIILAAVLGNALVIISVQRNRKLR-VITNYFVVSLAMA 184
            |.:.::|:.|    |.|..:|.....|.:||:.:|||.||..:|.|.|.|| .:||:||:|||::
  Rat     4 NTSTMDEAGLPAERDFSFRILTACFLSLLILSTLLGNTLVCAAVIRFRHLRSKVTNFFVISLAVS 68

  Fly   185 DMLVALCAMTFNASVELSGGKWMFGPFMCNVYNSLDVYFSTASILHLCCISVDRYYAIVRPLEYP 249
            |:|||:..|.:.|..|:: |.|.||.| ||::.:.|:..||||||:||.||||||:||..|.:|.
  Rat    69 DLLVAVLVMPWKAVAEIA-GFWPFGSF-CNIWVAFDIMCSTASILNLCVISVDRYWAISSPFQYE 131

  Fly   250 LNMTHKTVCFMLANVWILPALISFTPIFLGW------------YTTEEHLREISLHPDQCSFVVN 302
            ..||.|....:::..|.|..||||.|:.|.|            :|:.|...:     |.|...::
  Rat   132 RKMTPKAAFILISVAWTLSVLISFIPVQLSWHKAKPTWPLDGNFTSLEDTED-----DNCDTRLS 191

  Fly   303 KAYALISSSVSFWIPGIVMLVMY---WRIFKEAIRQRKALSRTSSNILLNSVHMGHTQQPTSLSY 364
            :.||:.||.:||:||..:|:|.|   :||.::.||:..||.|.       :||..:.|  |:...
  Rat   192 RTYAISSSLISFYIPVAIMIVTYTSIYRIAQKQIRRISALERA-------AVHAKNCQ--TTAGN 247

  Fly   365 LHPSDCDLNATS 376
            .:|.:|..:.:|
  Rat   248 GNPVECAQSESS 259

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Octbeta3RNP_001034048.2 7tm_4 146..>346 CDD:304433 87/215 (40%)
7tm_1 156..>344 CDD:278431 83/203 (41%)
Drd1NP_036678.3 7tm_1 39..331 CDD:278431 90/237 (38%)
7tm_4 40..>157 CDD:304433 57/118 (48%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.