DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Octbeta3R and Adrb2

DIOPT Version :9

Sequence 1:NP_001034048.2 Gene:Octbeta3R / 3885573 FlyBaseID:FBgn0250910 Length:1256 Species:Drosophila melanogaster
Sequence 2:NP_036624.2 Gene:Adrb2 / 24176 RGDID:2060 Length:418 Species:Rattus norvegicus


Alignment Length:296 Identity:104/296 - (35%)
Similarity:154/296 - (52%) Gaps:33/296 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly   100 SDSTFELLSTVGPN-ITANGSDIAVDNQAELEESW-LDLSLLLLKGFIFSSIILAAVLGNALVII 162
            :||.|.|    .|| ..|.|.||.    .|.:|:| :.:::|:      |.|:||.|.||.|||.
  Rat     6 NDSDFLL----APNGSRAPGHDIT----QERDEAWVVGMAILM------SVIVLAIVFGNVLVIT 56

  Fly   163 SVQRNRKLRVITNYFVVSLAMADMLVALCAMTFNASVELSGGKWMFGPFMCNVYNSLDVYFSTAS 227
            ::.:..:|:.:||||:.|||.||:::.|..:.|.|| .:....|.||.|.|..:.|:||...|||
  Rat    57 AIAKFERLQTVTNYFITSLACADLVMGLAVVPFGAS-HILMKMWNFGNFWCEFWTSIDVLCVTAS 120

  Fly   228 ILHLCCISVDRYYAIVRPLEYPLNMTHKTVCFMLANVWILPALISFTPIFLGWYTTEEHLREISL 292
            |..||.|:||||.||..|.:|...:|......::..|||:..|.||.||.:.||.. .|.:.|..
  Rat   121 IETLCVIAVDRYVAITSPFKYQSLLTKNKARVVILMVWIVSGLTSFLPIQMHWYRA-THKQAIDC 184

  Fly   293 HPDQ--CSFVVNKAYALISSSVSFWIPGIVMLVMYWRIFKEAIRQRKALSRTSSNILLNSVHMGH 355
            :..:  |.|..|:|||:.||.|||::|.:||:.:|.|:|:.|.||.:.:.::....        |
  Rat   185 YAKETCCDFFTNQAYAIASSIVSFYVPLVVMVFVYSRVFQVAKRQLQKIDKSEGRF--------H 241

  Fly   356 TQQPTSLSYLHPSDCDLNATS---AREETHSALSNL 388
            .|..:.:.....|...|..:|   .:|  |.||..|
  Rat   242 AQNLSQVEQDGRSGHGLRRSSKFCLKE--HKALKTL 275

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Octbeta3RNP_001034048.2 7tm_4 146..>346 CDD:304433 80/201 (40%)
7tm_1 156..>344 CDD:278431 75/189 (40%)
Adrb2NP_036624.2 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..23 8/20 (40%)
7tm_4 48..340 CDD:304433 86/240 (36%)
7tm_1 50..326 CDD:278431 85/238 (36%)
PDZ-binding 415..418
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 230 1.000 Domainoid score I2359
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 1 1.000 - - otm44908
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR24248
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
55.010

Return to query results.
Submit another query.