DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Octbeta3R and Taar4

DIOPT Version :9

Sequence 1:NP_001034048.2 Gene:Octbeta3R / 3885573 FlyBaseID:FBgn0250910 Length:1256 Species:Drosophila melanogaster
Sequence 2:NP_001008499.1 Gene:Taar4 / 209513 MGIID:2685072 Length:347 Species:Mus musculus


Alignment Length:242 Identity:72/242 - (29%)
Similarity:115/242 - (47%) Gaps:32/242 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly   145 IFSSIILAAVLGNALVIISVQRNRKLRVITNYFVVSLAMADMLVALCAMTFN--ASVELSGGKWM 207
            |....|:..:|||..||||:...::|...||:.::|:|..|.|::...|.|:  .|:|   ..|.
Mouse    39 IMIGAIVMTMLGNMAVIISIAHFKQLHSPTNFLILSMATTDFLLSCVVMPFSMIRSIE---SCWY 100

  Fly   208 FGPFMCNVYNSLDVYFSTASILHLCCISVDRYYAIVRPLEYPLNMTHKTVCFMLANVWILPALIS 272
            ||...|.|::..|:...|.||.|||.|||||:||:..||.|...:|.:.|...|...|.:|...:
Mouse   101 FGDLFCKVHSCCDIMLCTTSIFHLCFISVDRHYAVCDPLHYVTQITTRVVGVFLLISWSVPIFFA 165

  Fly   273 FTPIF--LGWYTTEEHLREISLHPDQCSFVVNKAYALISSSVSFWIPGIVMLVMYWRIFKEAIRQ 335
            |..:|  |.....|:.:..|.. ...|..:.||.:.:::|.::|::||.||:.:|..||..|.:.
Mouse   166 FGLVFSELNLIGAEDFVAAIDC-TGLCVLIFNKLWGVLASFIAFFLPGTVMVGIYIHIFTVAQKH 229

  Fly   336 RKALS---RTSSNILLNSVHMGHTQQPTSLSYLHPSDCDLNATSARE 379
            .:.:.   ||...:                     |:..:.|||.:|
Mouse   230 ARQIGTGPRTKQAL---------------------SESKMKATSKKE 255

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Octbeta3RNP_001034048.2 7tm_4 146..>346 CDD:304433 66/206 (32%)
7tm_1 156..>344 CDD:278431 64/194 (33%)
Taar4NP_001008499.1 7tm_4 34..>170 CDD:304433 48/133 (36%)
7tm_1 50..313 CDD:278431 69/231 (30%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
11.000

Return to query results.
Submit another query.