DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Octbeta3R and Htr4

DIOPT Version :9

Sequence 1:NP_001034048.2 Gene:Octbeta3R / 3885573 FlyBaseID:FBgn0250910 Length:1256 Species:Drosophila melanogaster
Sequence 2:NP_032339.2 Gene:Htr4 / 15562 MGIID:109246 Length:388 Species:Mus musculus


Alignment Length:274 Identity:108/274 - (39%)
Similarity:152/274 - (55%) Gaps:31/274 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly   123 VDNQAELEESWLDLSLLLLKGFIFSSIILAAVLGNALVIISVQRNRKLRVI-TNYFVVSLAMADM 186
            :|......|.:..:..::|..|: :.:||.|:|||.||:::|.|:|:||.| ||||:||||.||:
Mouse     4 LDANVSSNEGFRSVEKVVLLTFL-AVVILMAILGNLLVMVAVCRDRQLRKIKTNYFIVSLAFADL 67

  Fly   187 LVALCAMTFNASVELSGGKWMFGPFMCNVYNSLDVYFSTASILHLCCISVDRYYAI-VRPLEYPL 250
            ||::..|.|.| :||....|.:|...|.|..||||..:||||.||||||:|||||| .:||.|..
Mouse    68 LVSVLVMPFGA-IELVQDIWAYGEMFCLVRTSLDVLLTTASIFHLCCISLDRYYAICCQPLVYRN 131

  Fly   251 NMTHKTVCFMLANVWILPALISFTPIFLGWY------TTEEHLREISLHPDQCSFVVNKAYALIS 309
            .||...:..||...|:||..|||.||..||.      ..|:.....:.:...|.|:|||.||:..
Mouse   132 KMTPLRIALMLGGCWVLPMFISFLPIMQGWNNIGIVDVIEKRKFSHNSNSTWCVFMVNKPYAITC 196

  Fly   310 SSVSFWIPGIVMLVMYWRIF---KEAIRQRKALSRTSSNILLNSVHMGHTQQPTSLSYLHPSDCD 371
            |.|:|:||.::|::.|:||:   ||..:|.:.|.|..:               ||.|  .|...|
Mouse   197 SVVAFYIPFLLMVLAYYRIYVTAKEHAQQIQMLQRAGA---------------TSES--RPQPAD 244

  Fly   372 LNAT-SAREETHSA 384
            .::| ..|.||.:|
Mouse   245 QHSTHRMRTETKAA 258

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Octbeta3RNP_001034048.2 7tm_4 146..>346 CDD:304433 94/210 (45%)
7tm_1 156..>344 CDD:278431 90/198 (45%)
Htr4NP_032339.2 7tmA_5-HT4 20..323 CDD:320184 106/258 (41%)
TM helix 1 21..47 CDD:320184 11/26 (42%)
TM helix 2 55..81 CDD:320184 15/26 (58%)
TM helix 3 93..123 CDD:320184 21/29 (72%)
TM helix 4 136..159 CDD:320184 10/22 (45%)
TM helix 5 189..218 CDD:320184 13/28 (46%)
TM helix 6 252..282 CDD:320184 4/7 (57%)
TM helix 7 291..316 CDD:320184
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 1 1.000 - - otm42843
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 1 0.960 - -
43.960

Return to query results.
Submit another query.