DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Octbeta3R and ADRB3

DIOPT Version :9

Sequence 1:NP_001034048.2 Gene:Octbeta3R / 3885573 FlyBaseID:FBgn0250910 Length:1256 Species:Drosophila melanogaster
Sequence 2:NP_000016.1 Gene:ADRB3 / 155 HGNCID:288 Length:408 Species:Homo sapiens


Alignment Length:251 Identity:89/251 - (35%)
Similarity:136/251 - (54%) Gaps:17/251 - (6%)


- Green bases have known domain annotations that are detailed below.


  Fly    92 SPFSSYLSSDSTFELLSTVGPNITANGSDI-AVDNQAELEESWLDLSLLLLKGFIFSSIILAAVL 155
            :|:....||.:.:..|.|:.|| |||.|.: .|..:|            .|.|.:.:..:||.|.
Human     2 APWPHENSSLAPWPDLPTLAPN-TANTSGLPGVPWEA------------ALAGALLALAVLATVG 53

  Fly   156 GNALVIISVQRNRKLRVITNYFVVSLAMADMLVALCAMTFNASVELSGGKWMFGPFMCNVYNSLD 220
            ||.|||:::....:|:.:||.||.|||.||:::.|..:...|::.|: |.|..|...|.::.|:|
Human    54 GNLLVIVAIAWTPRLQTMTNVFVTSLAAADLVMGLLVVPPAATLALT-GHWPLGATGCELWTSVD 117

  Fly   221 VYFSTASILHLCCISVDRYYAIVRPLEYPLNMTHKTVCFMLANVWILPALISFTPIFLGWYT--T 283
            |...||||..||.::||||.|:..||.|...:|.:.....:..||::.|.:||.||...|:.  .
Human   118 VLCVTASIETLCALAVDRYLAVTNPLRYGALVTKRCARTAVVLVWVVSAAVSFAPIMSQWWRVGA 182

  Fly   284 EEHLREISLHPDQCSFVVNKAYALISSSVSFWIPGIVMLVMYWRIFKEAIRQRKAL 339
            :...:....:|..|:|..|..|.|:||||||::|.:|||.:|.|:|..|.||.:.|
Human   183 DAEAQRCHSNPRCCAFASNMPYVLLSSSVSFYLPLLVMLFVYARVFVVATRQLRLL 238

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Octbeta3RNP_001034048.2 7tm_4 146..>346 CDD:304433 74/196 (38%)
7tm_1 156..>344 CDD:278431 71/186 (38%)
ADRB3NP_000016.1 7tm_GPCRs 51..356 CDD:333717 72/189 (38%)
TM helix 2 73..95 CDD:320095 9/21 (43%)
TM helix 3 111..133 CDD:320095 9/21 (43%)
TM helix 4 156..172 CDD:320095 5/15 (33%)
TM helix 5 202..225 CDD:320095 12/22 (55%)
TM helix 6 288..313 CDD:320095
TM helix 7 325..350 CDD:320095
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 230 1.000 Domainoid score I2451
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 1 1.000 - - otm40768
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR24248
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
44.010

Return to query results.
Submit another query.