DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Octbeta3R and Hrh2

DIOPT Version :9

Sequence 1:NP_001034048.2 Gene:Octbeta3R / 3885573 FlyBaseID:FBgn0250910 Length:1256 Species:Drosophila melanogaster
Sequence 2:XP_036013748.1 Gene:Hrh2 / 15466 MGIID:108482 Length:421 Species:Mus musculus


Alignment Length:209 Identity:83/209 - (39%)
Similarity:122/209 - (58%) Gaps:3/209 - (1%)


- Green bases have known domain annotations that are detailed below.


  Fly   136 LSLLLLKGFIFSSIILAAVLGNALVIISVQRNRKLRVITNYFVVSLAMADMLVALCAMTFNASVE 200
            ::|.:....:.:::|...|.||.:|.::|..||:||.:||.|:||||..|:|:.|..|.|:|..:
Mouse    15 IALKVTISVVLTTLIFITVAGNVVVCLAVSLNRRLRSLTNCFIVSLAATDLLLGLLVMPFSAIYQ 79

  Fly   201 LSGGKWMFGPFMCNVYNSLDVYFSTASILHLCCISVDRYYAIVRPLEYPLNMTHKTVCFMLANVW 265
            || .||.||...||:|.||||...|||||:|..||:|||.|:..||.||:.:|...|...|..:|
Mouse    80 LS-FKWSFGQVFCNIYTSLDVMLCTASILNLFMISLDRYCAVTDPLRYPVLVTPVRVAISLVFIW 143

  Fly   266 ILPALISFTPIFLGWYTTEEHLREISLHPDQCSFVVNKAYALISSSVSFWIPGIVMLVMYWRIFK 330
            ::...:||..|.|||  ...:.........:|...||:.|.|:...|:|::|.::|.|.|:||||
Mouse   144 VISITLSFLSIHLGW--NSRNGTRGGNDTFKCKVQVNEVYGLVDGMVTFYLPLLIMCVTYYRIFK 206

  Fly   331 EAIRQRKALSRTSS 344
            .|..|.|.::..||
Mouse   207 IAREQAKRINHISS 220

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Octbeta3RNP_001034048.2 7tm_4 146..>346 CDD:304433 82/199 (41%)
7tm_1 156..>344 CDD:278431 78/187 (42%)
Hrh2XP_036013748.1 7tmA_Histamine_H2R 19..298 CDD:320179 82/205 (40%)
TM helix 1 21..45 CDD:320179 6/23 (26%)
TM helix 2 54..76 CDD:320179 11/21 (52%)
TM helix 3 92..114 CDD:320179 13/21 (62%)
TM helix 4 137..153 CDD:320179 4/15 (27%)
TM helix 5 179..202 CDD:320179 7/22 (32%)
TM helix 6 232..254 CDD:320179
TM helix 7 266..291 CDD:320179
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 1 1.000 - - H40613
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
32.870

Return to query results.
Submit another query.