DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Octbeta3R and ADRB1

DIOPT Version :9

Sequence 1:NP_001034048.2 Gene:Octbeta3R / 3885573 FlyBaseID:FBgn0250910 Length:1256 Species:Drosophila melanogaster
Sequence 2:NP_000675.1 Gene:ADRB1 / 153 HGNCID:285 Length:477 Species:Homo sapiens


Alignment Length:222 Identity:82/222 - (36%)
Similarity:127/222 - (57%) Gaps:8/222 - (3%)


- Green bases have known domain annotations that are detailed below.


  Fly   143 GFIFSSIILAAVLGNALVIISVQRNRKLRVITNYFVVSLAMADMLVALCAMTFNASVELSGGKWM 207
            |.:.:.|:|..|.||.|||:::.:..:|:.:||.|::|||.||:::.|..:.|.|:: :..|:|.
Human    62 GLLMALIVLLIVAGNVLVIVAIAKTPRLQTLTNLFIMSLASADLVMGLLVVPFGATI-VVWGRWE 125

  Fly   208 FGPFMCNVYNSLDVYFSTASILHLCCISVDRYYAIVRPLEYPLNMTHKTVCFMLANVWILPALIS 272
            :|.|.|.::.|:||...||||..||.|::|||.||..|..|...:|......::..||.:.||:|
Human   126 YGSFFCELWTSVDVLCVTASIETLCVIALDRYLAITSPFRYQSLLTRARARGLVCTVWAISALVS 190

  Fly   273 FTPIFLGWYTTE-EHLREISLHPDQCSFVVNKAYALISSSVSFWIPGIVMLVMYWRIFKEAIRQR 336
            |.||.:.|:..| :..|.....|..|.||.|:|||:.||.|||::|..:|..:|.|:|:||.:|.
Human   191 FLPILMHWWRAESDEARRCYNDPKCCDFVTNRAYAIASSVVSFYVPLCIMAFVYLRVFREAQKQV 255

  Fly   337 KALSRTSSNILLNSVHMGHTQQPTSLS 363
            |.:.......|      |...:|.|.|
Human   256 KKIDSCERRFL------GGPARPPSPS 276

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Octbeta3RNP_001034048.2 7tm_4 146..>346 CDD:304433 76/200 (38%)
7tm_1 156..>344 CDD:278431 73/188 (39%)
ADRB1NP_000675.1 7tm_4 67..>266 CDD:304433 76/199 (38%)
7tm_1 75..377 CDD:278431 78/209 (37%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 269..307 3/8 (38%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 403..477
PDZ-Binding 474..477
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 230 1.000 Domainoid score I2451
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D328277at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 1 1.000 - - otm40768
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR24248
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
55.020

Return to query results.
Submit another query.